KEGG   Paralichthys olivaceus (Japanese flounder): 109625110
Entry
109625110         CDS       T06037                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04310  Wnt signaling pathway
pov04340  Hedgehog signaling pathway
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109625110 (ccnd1)
   04340 Hedgehog signaling pathway
    109625110 (ccnd1)
   04371 Apelin signaling pathway
    109625110 (ccnd1)
   04068 FoxO signaling pathway
    109625110 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109625110 (ccnd1)
   04115 p53 signaling pathway
    109625110 (ccnd1)
   04218 Cellular senescence
    109625110 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109625110 (ccnd1)
   04530 Tight junction
    109625110 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109625110
NCBI-ProteinID: XP_019935765
LinkDB
Position
Unknown
AA seq 292 aa
MEDQLLCCEVDSIRRAYQDVNLLNDRVLHTMLKAEETYLPSPNYFKCVQKEIIPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSIQPGELLQMELLVLNKLKWDLASVTPHDFIEHFLSKLKIYPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDASLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHSSTTETKHMDDDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggaccagctactgtgctgcgaggtggactccatcaggagagcctaccaggacgtt
aacctgctcaacgaccgggttctccacacaatgctgaaggcagaggaaacctacctaccg
tctcccaactacttcaagtgtgttcagaaagaaatcattcctaaaatgcggaaaatagtt
gccacatggatgttagaggtctgcgaagaacagaaatgcgaggaggaagttttccccctt
gctatgaactatttggacagatttttatcagtggaggccaccaggaaaactcgactacag
ctgctgggagccacatgcatgtttctagcatctaagatgaaggagacagttccgttaaca
gcagagaaactctgtatctacacagacaactcaattcagcctggagaactactgcaaatg
gaactgctggttctcaacaagctgaagtgggatctggcttcagtcacacctcacgacttc
attgaacactttctgtccaagctgaagatctacccgtccaccaagcagatcctgaggaag
catgcccagacctttgtggcactctgtgctacagatgttaacttcattgccagtcctcca
tccatggtggcagcaggcagtgtggttgcagctgttcaaggtctctacctgaagagtcaa
gatgcctccttgtcctcccagaacctcaccaacttcctgtcgcaagtcattcgcagtgac
ccggactgcctgcgttcatgtcaggagcagatagagtctttgctagaatcaagcctgagg
caggctcagcaacacagcagcacaacagaaaccaaacacatggatgacgacgtggacctg
tcctgcaccccaacagacgtcagagacataaacatctga

DBGET integrated database retrieval system