KEGG   Paralichthys olivaceus (Japanese flounder): 109625138
Entry
109625138         CDS       T06037                                 

Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04141  Protein processing in endoplasmic reticulum
pov04210  Apoptosis
pov04217  Necroptosis
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109625138
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109625138
   04217 Necroptosis
    109625138
   04115 p53 signaling pathway
    109625138
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109625138
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109625138
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pov03029]
    109625138
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pov02000]
    109625138
Mitochondrial biogenesis [BR:pov03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109625138
Transporters [BR:pov02000]
 Other transporters
  Pores ion channels [TC:1]
   109625138
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 109625138
NCBI-ProteinID: XP_019935804
LinkDB
Position
Unknown
AA seq 204 aa
MADSREGREEGEQEPQGAVGGEDVIDDPILEQGAVVLRGYVIERINAQDPGRQVCSEDLG
GRPNEQQDPQIKEVVEQLLKIADDLNRNAELRLLINQVQGNCAQDVFMKVARSIFVDGIN
WGRVVALFHLAYRLIHKALTTNHLENIRMVISWFLQAVREMLYPWLVQQGGWEGVIRGFS
RWRTAAIVASVVLVATIVYYRKTR
NT seq 615 nt   +upstreamnt  +downstreamnt
atggctgacagccgggaaggaagagaagagggagagcaggagcctcagggcgccgtggga
ggggaagatgtcattgatgatcccatcctggagcaaggggcagtggtcctcaggggatac
gtgattgagcgcataaacgcgcaggaccctggtcgacaggtctgctctgaggatctggga
ggacggcctaatgaacaacaggatccacaaatcaaagaagtggtggaacagctgctcaag
attgcagatgatttgaacaggaatgctgagcttcgactactgatcaaccaggtccaaggt
aactgtgctcaggacgtcttcatgaaggtggccaggagtatatttgttgatggaatcaac
tggggtagagtggtggctctcttccatctggcctacagactcatacacaaggcactgacc
accaaccatttagagaacatcagaatggtcatcagttggtttctccaggccgtcagagag
atgctttacccctggctagtacaacagggaggctgggaaggggtgatccgtggcttttct
cggtggaggacagcagcaatagtagcctcagttgtactggtggcaaccattgtttactac
aggaagacacgctga

KEGG   Paralichthys olivaceus (Japanese flounder): 109631661
Entry
109631661         CDS       T06037                                 

Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04141  Protein processing in endoplasmic reticulum
pov04210  Apoptosis
pov04217  Necroptosis
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109631661
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109631661
   04217 Necroptosis
    109631661
   04115 p53 signaling pathway
    109631661
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109631661
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109631661
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pov03029]
    109631661
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pov02000]
    109631661
Mitochondrial biogenesis [BR:pov03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109631661
Transporters [BR:pov02000]
 Other transporters
  Pores ion channels [TC:1]
   109631661
SSDB
Motif
Pfam: Bcl-2 BID
Other DBs
NCBI-GeneID: 109631661
NCBI-ProteinID: XP_019946091
LinkDB
Position
Unknown
AA seq 196 aa
MACDGLSDERIGKALIKDVIEEELKHTASDDVPSLTLYTVELKNEEDKLVDQVSTLVRKI
GDKIKDDVEIRDEIDGLARGFRWDRFNSVANKVLEDGITWEKIAVLIYVASKLAVRMVEA
HMPQSVMEILKCTVDFFKKHLLSWILQRGGWICSFSELAVASMQTASSMSSDRGGLVITF
FAGIALGGFITWRLTR
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcgtgtgatggcttgtctgatgagaggataggaaaggccctgatcaaagatgtaatt
gaggaggaactgaaacacacagcctcagacgacgtcccgtccctcaccctctatactgtg
gaattaaagaatgaggaggacaagcttgtggaccaggtgagcacattggtccgcaaaatt
ggtgacaaaataaaggatgacgtggagatccgagatgaaatagacgggcttgcacgaggt
ttcaggtgggacagatttaactcagtggcaaacaaggtgcttgaggatgggatcacctgg
gagaagattgctgtgctaatctatgttgccagcaagttggcagtcagaatggtggaggct
catatgcctcagtcagtgatggagatcctgaagtgcaccgtggactttttcaaaaaacat
ctcctttcctggattttgcagcgaggaggatggatctgcagcttctcagagctggcggtg
gcgtccatgcagaccgcgtcatccatgagctctgacagaggaggccttgtcatcaccttc
ttcgccggcatagctctcggaggcttcatcacctggagactgacccgttga

KEGG   Paralichthys olivaceus (Japanese flounder): 109634241
Entry
109634241         CDS       T06037                                 

Gene name
bax
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04141  Protein processing in endoplasmic reticulum
pov04210  Apoptosis
pov04217  Necroptosis
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109634241 (bax)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109634241 (bax)
   04217 Necroptosis
    109634241 (bax)
   04115 p53 signaling pathway
    109634241 (bax)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109634241 (bax)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109634241 (bax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pov03029]
    109634241 (bax)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pov02000]
    109634241 (bax)
Mitochondrial biogenesis [BR:pov03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109634241 (bax)
Transporters [BR:pov02000]
 Other transporters
  Pores ion channels [TC:1]
   109634241 (bax)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 109634241
NCBI-ProteinID: XP_019950156
LinkDB
Position
Unknown
AA seq 192 aa
MASHPGGDDPGNTRDQILEVGTVLLKDFIYKRVQRHGDSNTSVTRAQLGGGELCNPNHKK
LAQCLQQIGDELDGNVELQRMINNSSLSPTKEMFMKVAIEIFSDGKFNWGRVVALFYFAC
RLVIKALVTQVPDIIKTIISWTMDYLRENLISWIREQGGWDGICSYFGTPTWQTVGVFLA
GVLTTVLVIRKM
NT seq 579 nt   +upstreamnt  +downstreamnt
atggcatctcacccaggaggagacgacccaggaaataccagagatcagatactggaagtg
ggaactgttttgctcaaggattttatctacaagcgggttcagagacacggagacagcaat
acttcagtgaccagggcacagctgggtggaggagagctgtgtaacccgaaccacaagaag
ctcgcccaatgtctgcaacagatcggagacgagctggatggaaatgtagagctccagagg
atgataaataactcctcactcagtcccactaaggaaatgtttatgaaggttgccatcgag
atcttttcggatggaaaattcaactggggcagggtggtcgcactcttctactttgcctgt
cgacttgtcatcaaagctcttgtgacccaagttccggatatcattaaaaccatcattagc
tggaccatggattacctccgtgaaaatttgatcagctggatcagggagcaaggtggctgg
gatggtatttgttcctacttcggcactcctacatggcagacagtgggagttttcttggct
ggtgttctcaccactgttcttgtcattcgaaagatgtga

DBGET integrated database retrieval system