KEGG   Paralichthys olivaceus (Japanese flounder): 109625451
Entry
109625451         CDS       T06037                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109625451
   04068 FoxO signaling pathway
    109625451
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109625451
   04210 Apoptosis
    109625451
   04115 p53 signaling pathway
    109625451
   04218 Cellular senescence
    109625451
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pov03036]
    109625451
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109625451
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109625451
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109625451
NCBI-ProteinID: XP_019936226
LinkDB
Position
Unknown
AA seq 158 aa
MCNMTLEESSGDNSSERMDSVAKALEEVLSSALPQGCITVGVYEAAKSLNADPDNVVLCL
LATDDEEEDVALQIHFTLIQAFCCENDINILRVSNMRRLAEILGGVKPGGEPMDLHCVLV
TNPQSSLWKNPALSKVNRFCRDSRCLDQWVPVINLPDR
NT seq 477 nt   +upstreamnt  +downstreamnt
atgtgcaatatgactttagaagaaagcagcggggacaattcgtcagaaaggatggactcg
gtggccaaagcgttagaggaggtcctgagctctgcattgcctcagggttgcatcactgtc
ggtgtgtacgaggcagcaaagtcactgaacgcggacccagacaacgtggtgctgtgtctg
ctggccacagacgacgaggaggaggacgtggctcttcagattcatttcaccttaatccag
gcattctgctgcgagaatgacatcaacatcctgcgggtgagcaacatgaggcgtctggcg
gagatcctcggtggagtcaaacctggaggggagcccatggacctgcactgtgttctagtt
actaatccccagtcgtcactgtggaagaaccctgcgctgagcaaagtgaacagattctgc
agagacagtcgctgtttggatcaatgggtgcctgtcatcaacctgcccgaccgatga

KEGG   Paralichthys olivaceus (Japanese flounder): 109636370
Entry
109636370         CDS       T06037                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like isoform X1
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109636370
   04068 FoxO signaling pathway
    109636370
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109636370
   04210 Apoptosis
    109636370
   04115 p53 signaling pathway
    109636370
   04218 Cellular senescence
    109636370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pov03036]
    109636370
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109636370
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109636370
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109636370
NCBI-ProteinID: XP_019953570
LinkDB
Position
Unknown
AA seq 150 aa
MIPEESFDSIENRMQSVGLALEELLVTAQKQDCLTIGIYESAKLFNADPDSVVLCVLAGD
DEDDVALQIHFTLLQSFCCDSGITILRVSGAQRLQQLLGSVDANRNQEDLHCMLVTNPQA
NHCRLQEVGTYCQESRRLNQWVPELVLQER
NT seq 453 nt   +upstreamnt  +downstreamnt
atgattccagaggagagctttgactccatcgagaacaggatgcagtctgtgggtctggct
ctggaggagctgctggtaacggctcagaaacaagactgcctcaccatcggcatctatgaa
tctgcaaaactttttaatgcggacccagacagcgtggtgctgtgcgtcctggcaggtgat
gatgaagacgatgtggcactgcagatccacttcaccctgctacagtcgttctgctgcgac
agcggcatcaccatcctgcgagtctctggcgctcagcggctccagcagctgctaggatcg
gtggatgccaacagaaaccaggaggaccttcactgcatgctagttacgaacccccaggct
aaccactgcaggctacaagaggtggggacctactgccaggagagccgacgcctcaaccag
tgggtacctgagctggtcctgcaagaacgatga

KEGG   Paralichthys olivaceus (Japanese flounder): 109637499
Entry
109637499         CDS       T06037                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109637499
   04068 FoxO signaling pathway
    109637499
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109637499
   04210 Apoptosis
    109637499
   04115 p53 signaling pathway
    109637499
   04218 Cellular senescence
    109637499
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pov03036]
    109637499
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109637499
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109637499
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109637499
NCBI-ProteinID: XP_019955447
LinkDB
Position
Unknown
AA seq 163 aa
MYKMTFEELNGDYSQERMDSVAKALEEVLSSALPQGCITVGVYEAAKSLNVDPDNVVLCI
LATDDEDVKDVALQIHFTLIQAFCCENDINILRVNNTGRLAEILGGGAGGKQAGGEPMDL
HCVLVTSPHSTSWKDPALSKVNRFCRESRCMDQWVPIINLPER
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtacaaaatgacatttgaggagctaaacggagattattctcaagaaaggatggattca
gtagcgaaggctttggaagaagtcctcagctctgctctgccacagggctgcatcacagtc
ggtgtgtacgaggctgccaagtctctcaacgtagaccctgacaatgtggttttgtgcatc
ctggccaccgatgacgaggacgtgaaagatgtggcgctgcagatccacttcaccctcatc
caggctttctgctgcgagaatgacatcaacatcctcagagtcaacaacaccgggcgcctg
gcagagatcctgggtggaggagctggtgggaaacaggccggaggggaacccatggacctc
cactgtgtcctggtcactagcccacactcgacgtcgtggaaggaccccgctttgagcaag
gtgaaccgcttctgcagagagagccgctgtatggaccagtgggtaccaatcatcaacctg
cctgagcgatga

KEGG   Paralichthys olivaceus (Japanese flounder): 109639301
Entry
109639301         CDS       T06037                                 

Gene name
gadd45g
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109639301 (gadd45g)
   04068 FoxO signaling pathway
    109639301 (gadd45g)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109639301 (gadd45g)
   04210 Apoptosis
    109639301 (gadd45g)
   04115 p53 signaling pathway
    109639301 (gadd45g)
   04218 Cellular senescence
    109639301 (gadd45g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pov03036]
    109639301 (gadd45g)
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109639301 (gadd45g)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109639301 (gadd45g)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109639301
NCBI-ProteinID: XP_019958246
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEIRGQENAMENADRVQSAGAALEELLLSAKKQDYLTVGVYESAKVMNVDPDSVAFC
VLATDEEYECDIALQIHFTLIQAFCFDNDINVVRVNDIERLADLVGTDGTGEPKDAHCIL
VTSPSANPWKDPALDKLSHFCEESRSAYDWVPTITLPER
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagagatccgcggacaagagaacgcaatggaaaacgcagatagggtgcaa
agtgcaggcgcagcgctggaggagctgctcctctccgccaagaagcaggactacctgaca
gtgggagtctacgaatctgccaaagtcatgaatgttgatccagacagcgtggctttctgc
gtcctcgccacggatgaggaatacgagtgtgacatcgctctccagatccacttcaccctc
atccaggctttctgcttcgacaacgacatcaacgtggtgcgcgtcaacgacatcgagcgc
ctggctgacctcgtgggcacagacggcaccggcgagcccaaggacgcgcactgcattctt
gtcacgagccccagtgcaaacccatggaaagaccccgctctggacaagctgagccatttc
tgtgaggagagccgaagtgcctatgactgggtgcccaccatcaccctcccagagcgctga

KEGG   Paralichthys olivaceus (Japanese flounder): 109643194
Entry
109643194         CDS       T06037                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109643194
   04068 FoxO signaling pathway
    109643194
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109643194
   04210 Apoptosis
    109643194
   04115 p53 signaling pathway
    109643194
   04218 Cellular senescence
    109643194
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pov03036]
    109643194
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109643194
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109643194
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109643194
NCBI-ProteinID: XP_019963788
LinkDB
Position
Unknown
AA seq 140 aa
MESPGKSLKEALLCAQSEDRLTAGVYESAKIMTDDPDSVSFCVLATDEEFECDIALQIHF
TLIQSFCFDNDISIVRVSDMQRLAEIVGDKAEQLEDAHCVLITNPADGSWEDPALEKLHL
FCEESRRLNDWVPEVSLPGR
NT seq 423 nt   +upstreamnt  +downstreamnt
atggagtctcctggaaaatctctgaaggaagctctgctctgtgctcagagcgaggaccga
ctcactgccggagtctacgagagcgctaaaatcatgactgatgaccctgacagcgtgtct
ttctgcgtcctggccacggacgaggagttcgagtgtgacatcgctctgcagatccacttc
accctcatccagtccttctgcttcgacaacgacatcagcatcgtcagagtgagcgacatg
cagcgtctggctgagatcgttggtgacaaggcggagcagctggaagacgctcactgcgtc
ctcatcacgaacccagctgacggctcttgggaggaccctgctctggagaagctgcatctg
ttctgtgaggagagccgccgtctgaacgactgggtccctgaggtcagcctccccggccgc
tga

KEGG   Paralichthys olivaceus (Japanese flounder): 109644407
Entry
109644407         CDS       T06037                                 

Gene name
gadd45b
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109644407 (gadd45b)
   04068 FoxO signaling pathway
    109644407 (gadd45b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109644407 (gadd45b)
   04210 Apoptosis
    109644407 (gadd45b)
   04115 p53 signaling pathway
    109644407 (gadd45b)
   04218 Cellular senescence
    109644407 (gadd45b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pov03036]
    109644407 (gadd45b)
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109644407 (gadd45b)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109644407 (gadd45b)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109644407
NCBI-ProteinID: XP_019965333
LinkDB
Position
Unknown
AA seq 174 aa
MIFTLDLVDYLSDVMTLEEVIGPNCTDRRMETVRAALEQLLVAAQRQNCLTVGVYESAKL
MNVDPDSVVLCVLATDEEDEDDIALQIHFTLLQAFCCDNDINIMRVSGVRRLAHVLEEDT
EDSNGNEPRDLHCILVTNPPVQPLQCPALQEVSSFCDESRCRNQWVPCLALQER
NT seq 525 nt   +upstreamnt  +downstreamnt
atgatctttactctggacctggtggattatttatctgacgtcatgactctggaggaagtg
atcggaccgaactgcaccgacagaaggatggagacggtgcgcgcggccctggagcagctg
ctggtcgcagcgcagcgacagaactgtctgactgtgggcgtgtacgagtccgccaaactc
atgaatgtggacccggacagcgtggttctgtgcgtgctcgccaccgatgaggaggatgaa
gatgacatcgcgctgcagatccacttcacgctgcttcaggcgttctgctgcgacaacgac
atcaacatcatgcgcgtgtccggcgtcaggaggctcgctcacgtgctggaggaggacacc
gaggacagtaacgggaacgagcccagggacctgcactgcatcctggtcacgaaccccccg
gtgcagccgctgcagtgtccggccctgcaggaggtcagcagcttctgtgacgagagtcgc
tgcaggaaccagtgggtcccgtgcttggcgctgcaggaacgctga

DBGET integrated database retrieval system