KEGG   Paralichthys olivaceus (Japanese flounder): 109625664
Entry
109625664         CDS       T06037                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04020  Calcium signaling pathway
pov04144  Endocytosis
pov04510  Focal adhesion
pov04540  Gap junction
pov04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109625664 (pdgfra)
   04020 Calcium signaling pathway
    109625664 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109625664 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109625664 (pdgfra)
   04540 Gap junction
    109625664 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109625664 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109625664 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pov04090]
    109625664 (pdgfra)
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109625664 (pdgfra)
Protein kinases [BR:pov01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109625664 (pdgfra)
CD molecules [BR:pov04090]
 Proteins
  109625664 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set C2-set_2 Herpes_gE
Other DBs
NCBI-GeneID: 109625664
NCBI-ProteinID: XP_019936564
LinkDB
Position
Unknown
AA seq 1471 aa
MDGVKVYVVCWGISVLLVAVTSGLSPPTIVSNEEEFILQPNSVFNISCTGKRNVVWAEPL
PANTFVYPGYYTATLFIYNATVENTGYYMCVYESQEGKVESEPGEDNEAGIYVFVPDPQA
PFVPETPENVEVPMDTTGVPISCRVSDPYTDVILRSVPSGEEMLAFYDNKMGFFGSLAPG
QYQCETTVNGQTARSVVYTVRIEAPAEMEDFTVEVKASEESVRAGQPFNITCIAPAGLGF
QQQWLHPKKQAVGAVQMKKTLPVQVIYILSIPQATAQDSGTYECSITHGISGEVRVSSVA
VTVFEDNSFVALDHSGILVTEFVSLLEETEFTILINAYPAPKVIWLKDGKALPGNYYVLT
KTSHIEGNRYQSILTLRQPLEKDNGNYTITVLSGSRTAQFSFTLKVKAPTAMMFPPSSAP
VLLPQRDEMVVLLHTPFTLTCRGEAKLVWETPLHVLELSQEDNSGLFVSTITVDVATAVH
TGYYTCFYSGNTTEDMEDSSIYIYVPDPDVPFVPSPVPFGNHVLSDHEEMEIQCRVSDPT
ANVTLVNVDTQQPVPSVYDSKRGALGVFTAGTYICKALINGEEHYSGEYIVHGWTGGVSL
HVELTAKRTALLVGETIAVTCLARGSEILEDHWKYPGKLANRGTKTVHENKRDQEILYTL
TIPQATTKDSGIYSCSITDIISNESQTKQLAIRVFGSEFMSIKPHFEDYESAELDEVRDF
KAEINSFPTAHVTWLKDGVPLSDVTAEISTSLRQLSETSYMSILTLIRAKEEDSGNYTMR
VENGNQSQDVSLILEVKVPAVIVELMDIHHGSATGQSVVCITRGQPTPVVEWFICKNIKH
CANDSSSWVPLSTNSTKITVDSHIDEDNNLESQVMFGHLENTLAVRCLAKNEMAAVSREV
KLVSNGPHPELTVAAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESVSPDGHEYIY
VDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTAR
SSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRESFM
SLNPEKSKKELDIFGINPADESSRSYVILSFESKGDYMDMKQGDNTQYVPMLEMSNAPKY
SDIQTSNYDHPPSQKDSSEGDMDNLLSDDMNEGLTTTDLLSFTYQVAKGMEFLASKNCVH
RDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTLS
DVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPNDVYEMMMKCWNSE
PEKRPSFLGLSDTVGSLLPSSYKRHYERVNQKFLKSDHPAVTRVCLENDDAYIGITYKNQ
GKLKDRESGFDEQRLSSDSGYIIPLPDLDPISDDEYGKRNRHSSQTSEESAIETGSSSST
FAKREGETLEDITLLDEMCLDCSDLVEDSFL
NT seq 4416 nt   +upstreamnt  +downstreamnt
atggatggggtgaaggtgtatgtcgtctgttggggtatttcggtgcttcttgttgcagtc
actagcggactgtcgccaccaaccattgtgtccaatgaggaggagttcatcctgcagcct
aactctgtgttcaacatcagctgcacaggcaaaagaaacgttgtctgggccgaacccctg
ccggcaaacacttttgtttatccaggatactacactgccacgctcttcatttacaacgcc
acagtagaaaacaccggctactacatgtgtgtatatgaaagccaggagggcaaagtggag
agcgagccaggagaagacaatgaggcaggaatatatgtctttgtgccagatccccaggcc
ccatttgttccagagaccccagaaaacgttgaagtcccaatggacacgacaggagtcccc
atctcctgccgcgtgtctgacccgtacacagacgtcatcctcaggagcgtccccagtgga
gaggagatgctcgccttctatgacaacaagatgggcttcttcgggagcctcgctcctggg
cagtaccagtgtgaaaccacggtgaatggccagacagccagaagtgtagtttacactgtg
agaattgaggcccctgcagaaatggaggatttcacagtggaagtaaaagccagcgaggag
agcgtgagggccgggcagcctttcaacatcacctgcatcgctcccgctgggctgggcttt
cagcagcagtggctccatcccaaaaagcaggctgtgggagcagttcagatgaaaaagaca
ttacctgtgcaggtcatctacatcctcagtatcccacaagccactgctcaggacagcggc
acctacgagtgctccatcactcacggaatcagcggggaggtcagggtgagcagcgtggcc
gtcactgtcttcgaggacaattcttttgtggctctggaccacagcggcattctggtgacg
gagtttgtcagcctcttggaggagacagagtttactattctcatcaatgcctaccctgcc
cccaaagtgatatggctgaaagacggcaaagccttaccagggaactactatgtcctcacc
aaaacaagccacatcgaagggaatcggtatcaaagcattctgacattacgacagcctctt
gagaaagacaacggcaactataccatcacagtgctgagtggctctcgcactgcacagttc
tcctttaccctcaaagtgaaagctccaactgccatgatgttccctccatcctccgcccct
gtgctgctgccacagagagatgagatggtggtgcttctccacactcctttcaccttgacc
tgccgtggtgaggcaaagctggtctgggagacgccactccatgtgctggagctatcgcag
gaggacaacagcggcctgttcgtatccaccatcactgtggatgttgccactgcagtgcac
actggctactacacgtgcttctacagtggaaacacgactgaggacatggaggacagtagc
atttatatctatgtcccagatccagatgttccctttgtgccatcaccggtgccctttggt
aaccacgtcctgtccgaccatgaggagatggagatccagtgccgagtgtctgatcccact
gctaacgtgaccctggttaatgttgacacccagcagcctgtgcctagtgtttatgacagc
aagaggggcgctttgggggtattcactgctggaacgtacatttgtaaggccctcataaat
ggagaggaacactacagtggggagtacatcgtccacggctggacaggtggtgtctcgcta
catgttgagctgacagccaagcggactgctctgctggtgggagaaaccatcgcagtcacc
tgtctggctcggggatcagagattctggaagatcactggaaataccctggcaaactggct
aatcgtggtacaaaaaccgtgcatgaaaacaagagggatcaggagatcctttacaccctg
acgatcccgcaggctacgaccaaagacagcggcatctattcttgctccatcactgatatt
attagtaatgagagccagacaaagcaactcgctattagagtttttggaagtgagttcatg
tccatcaagccacactttgaagactatgagtcagcagagttggatgaggtccgggacttc
aaggccgaaatcaactccttccctactgctcacgtcacgtggctcaaagatggagtccca
ctcagcgacgtgacggcagagatctccaccagcctgcggcagctcagcgagaccagctac
atgagcattctcaccctgatccgcgccaaagaggaggacagcgggaactacacgatgcga
gtggagaatggaaaccaaagtcaggacgttagcttgatcctggaggtcaaagtgcctgca
gtcattgttgagctgatggacatccaccatggctcagccacaggccagtctgtggtgtgt
atcactcgagggcagcccactcctgtggtggagtggttcatctgcaagaacatcaaacat
tgtgccaatgactcgtcctcctgggttccgctttccaccaactccactaagatcacggtg
gactcccacatagacgaagacaacaacctggagagccaggtcatgtttggtcacctggag
aacacgctggcagtgcgctgcctggccaagaacgaaatggctgccgtcagcagggaggtc
aaactggtttccaacggccctcaccctgagctgactgtagctgctgctgtgctggtgctc
ctggtcattgtcatcatctcactcattgtcttggttattatctggaaacagaaacctcga
tatgagatccgttggagggtcatagagtctgtgagtccagatggccacgagtacatttac
gtggatcccatgcagcttccctacgactccagatgggagttcccccgcgacagacttgtg
ctcggtcgtatcctgggttctggagcctttgggaaggtagtggagggcaccgcctacgga
ctcagccgctcccaacctgtcatgaaggtggcagtgaagatgctgaaacccacagcacgc
tccagtgagaaacaagccctgatgtctgaactgaagattatgactcatctcggacctcat
ctcaacattgttaacctcctgggagcatgcaccaagtcaggccccatctacatcatcaca
gagtactgcttctacggggacctggtcaactacctgcacaagaacagagagagcttcatg
agcctgaacccagagaaaagtaaaaaagagctggacatcttcgggatcaaccctgcagat
gagagcagcaggagttatgtgatcctgtccttcgagagcaaaggagactacatggacatg
aagcaaggggacaacactcagtacgtgcccatgctggagatgagcaatgcccccaaatac
tcagacatccagacatccaactacgaccacccaccctcgcagaaagactccagtgagggt
gacatggacaacctgttgtcggacgacatgaacgagggcctcaccaccaccgacctgctc
agcttcacataccaggtggctaaaggcatggagttcctggcttccaaaaactgtgtgcat
cgagacctcgcagccaggaatgtcctcctctctcagggcaagattgtgaagatctgtgac
ttcggactggccagagacatcatgcatgacaacaactatgtctccaaaggcagcactttt
ctgcctgtgaagtggatggcaccagagagtatttttgacaatctctacacgaccctcagc
gatgtttggtcctacggcatcctcctctgggagatattctccttaggtggcaccccatac
ccagggatggtcgtggattcaagcttctacaacaagatcaagagtggatacaggatgtcc
aagcctgagcatgcgcctaatgacgtgtatgaaatgatgatgaagtgctggaacagcgag
ccagagaagaggccttctttcttgggtctgagtgatactgtagggtccttgctgccctcc
agctacaagcggcattatgagagggtgaaccagaagttcctgaagagtgaccaccctgcc
gtgactcgagtgtgcttggagaacgacgacgcctacattggcatcacatacaagaaccag
ggcaagctgaaggaccgggaaagcggcttcgacgagcagcggctgagctccgacagcggc
tacattattcctctccccgacctggaccctatatctgatgatgaatatggaaagaggaac
agacacagctctcagacatccgaggagagcgccatcgagactggctccagcagctccact
tttgctaagcgggagggcgagaccctggaggacatcacgctgctggacgagatgtgtctg
gactgtagtgacctggtagaggacagctttctgtga

DBGET integrated database retrieval system