KEGG   Paralichthys olivaceus (Japanese flounder): 109626051
Entry
109626051         CDS       T06037                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04060  Cytokine-cytokine receptor interaction
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04217  Necroptosis
pov05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109626051
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109626051
   04217 Necroptosis
    109626051
   04115 p53 signaling pathway
    109626051
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109626051
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pov04050]
    109626051
   04090 CD molecules [BR:pov04090]
    109626051
Cytokine receptors [BR:pov04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109626051
CD molecules [BR:pov04090]
 Proteins
  109626051
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 109626051
NCBI-ProteinID: XP_019937270
LinkDB
Position
Unknown
AA seq 281 aa
MATLLIAGLVCHSADLPASQWSGEEYRNLTLRQHRTCVENEQYLHQRLCCLNCHAGSFVQ
KACERDQEQGTCLPCEHGQTYTAHSNGMNRCLPCTHCRLDEIETVPCSTTTDTKCQCKQG
TFCVPEQACEVCKRCAKCKPGEEEVKKCTPTSNTVCRKRDPSPTETSPALPTPTPSAAAD
KGSEKSLKKSFDLFDEYLDVRIHNKFFRLIGVSDNHIRIAENGPAGDKVYDLLKNWMQRQ
GLKADINNLLDALLSMDQRRSAESIASMALQRGYYKHADTP
NT seq 846 nt   +upstreamnt  +downstreamnt
atggccacactcctcattgctgggctggtgtgtcactcagcggacctcccggcatcgcag
tggtccggcgaggaatacagaaacctcacgctgcgacaacacagaacctgcgtggagaac
gagcagtacctccaccagagactctgctgccttaactgccatgcaggatcctttgtgcag
aaggcctgtgagagagaccaagagcaagggacgtgtcttccctgtgagcacggacagaca
tacactgcacactccaacgggatgaaccgctgtctgccgtgcacacactgccgtttagat
gagattgaaactgtgccgtgcagcacaacaacggacaccaagtgccagtgcaagcagggg
accttctgcgtgccagaacaggcctgtgaagtctgcaaacgttgtgccaagtgtaaacca
ggggaggaggaggtgaagaagtgcacccccacttctaacacagtgtgtcgaaaacgggat
ccgtccccgaccgaaacctctccagcccttcctactccgaccccttcagccgcagccgac
aaagggtcagaaaaatccctaaagaagagcttcgatttgtttgacgagtacttggacgtg
cggatccacaacaagttcttccgattgatcggagtcagcgacaaccacattcggatcgcg
gaaaacggccccgccggcgacaaagtttatgacctactgaagaactggatgcagaggcag
ggactaaaagccgacatcaacaacctgctagacgctctgctaagcatggaccagcggcgc
tcggcagagagcatcgcctccatggcgctgcagagaggctactataagcacgcagacacg
ccctga

KEGG   Paralichthys olivaceus (Japanese flounder): 109633911
Entry
109633911         CDS       T06037                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B-like isoform X1
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04060  Cytokine-cytokine receptor interaction
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04217  Necroptosis
pov05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109633911
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109633911
   04217 Necroptosis
    109633911
   04115 p53 signaling pathway
    109633911
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109633911
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pov04050]
    109633911
   04090 CD molecules [BR:pov04090]
    109633911
Cytokine receptors [BR:pov04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109633911
CD molecules [BR:pov04090]
 Proteins
  109633911
SSDB
Motif
Pfam: TNFR_c6 Death Miga ANAPC1 DUF4366 HemY_N
Other DBs
NCBI-GeneID: 109633911
NCBI-ProteinID: XP_019949661
LinkDB
Position
Unknown
AA seq 395 aa
MTALITVFRLLVLLLSSTGVFPQSRIDFGRRTQRDILCSDNQYLNGNNCCLNCPAGTHVK
SHCSKSGEKGQCQECDYRTYTAHPNELNQCFPCTPCRPDQEIVTPCSTTQDTECQCKAGR
FCDPHQACEVCKKCSKCEKDEEIERNCTSTTNTECKKIKPNSGSASGNKDVIAVVFPILG
IVAVAVAVAGVILYRRYRSTDSQSDLPEEIKVVQCSTEERRNRETRRPSASNCKLVRAIS
SVATEDQHNVYKSLNSSASNSQHSLTGLQAALPVTAVRPVFAWTPVSTEEEHILIPVNGE
ESLKKCFELFEEIEFDQHKRFFRHLGISDNVIKSKELDHYEDKIHDLLNIWLEQEGREAS
LNKLLKALLDLNQRRTAETVKEKAIANGHYFSVCL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaccgccctcatcacagtttttcgcctgttggtcttgctcctctcatccacgggggta
tttccgcagtcccgcattgactttggaaggaggacccagcgagatatcctctgctcagac
aatcagtacctgaacggcaacaactgctgcttaaactgtccagctggtacacatgtgaaa
tcacactgcagcaaatcaggagagaaggggcagtgtcaggaatgcgactacaggacatac
actgctcatcccaatgaactgaatcagtgtttcccgtgcacaccgtgtcgtccagatcag
gaaattgtaacgccgtgttcgaccactcaagatactgaatgtcagtgcaaagcgggaaga
ttttgtgatcctcaccaagcttgtgaagtatgcaagaaatgttcaaagtgtgaaaaggac
gaggagatagagcggaactgcacctctaccaccaacacagagtgcaagaaaatcaagccc
aactctggctcggcctcaggaaacaaagacgtgatagctgtagtcttcccgattcttggc
atagtagcagtagcagtagcagtagcaggagtaatcttgtataggagatacagatcaaca
gactctcagagtgatctgccagaggagattaaagttgtgcagtgttccactgaggaaagg
aggaacagagaaacccgaaggccaagcgcctctaactgtaaactggtgagagccatatcc
tctgtcgccacggaggatcagcataatgtgtataaaagcctcaacagctcagccagtaac
tcgcagcatagtctaaccggcctgcaagccgccttacctgtaaccgccgtcagacctgtg
tttgcctggacgcccgtcagtacggaagaggagcacatactcattcctgtgaatggtgaa
gagtctctgaagaaatgcttcgagctttttgaggaaattgagttcgaccaacacaagaga
ttcttccgtcaccttgggatcagcgacaatgtgattaaaagcaaagagcttgaccactat
gaagacaagatccatgacctgctgaatatttggttggagcaagagggcagagaggccagc
ctgaacaaactgctgaaagcattacttgacttaaatcaaaggcgaaccgcggagacggtc
aaggagaaagctattgccaatggtcattatttctctgtgtgcctatga

DBGET integrated database retrieval system