KEGG   Paralichthys olivaceus (Japanese flounder): 109626571Help
Entry
109626571         CDS       T06037                                 

Gene name
cercam
Definition
(RefSeq) probable inactive glycosyltransferase 25 family member 3
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00310  Lysine degradation
pov00514  Other types of O-glycan biosynthesis
pov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109626571 (cercam)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    109626571 (cercam)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pov01003]
    109626571 (cercam)
Enzymes [BR:pov01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     109626571 (cercam)
Glycosyltransferases [BR:pov01003]
 O-Glycan biosynthesis
  O-linked Gal type
   109626571 (cercam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 109626571
NCBI-ProteinID: XP_019938195
LinkDB All DBs
Position
Unknown
AA seq 591 aa AA seqDB search
MTPLLLALAALLLQADSYFSEEKYPEESKVQPPTVVIAIIARNTAHSLPYYLGALERLNY
PKERISVWAATDHNSDNTTAMLKEWLTFTQKFYHYVEWRPMDQPTSYAGELGPKHWPNSR
YEYVMKLKQAALNFARKRWADYILYVDTDNILTNPETLNLMIAENKSVIAPMLDSQGAYS
NYWCGITPQGYYRRTAEYFPTRHRHRLGCFPVPMVHSTVLLDLRKEGMKNLAFFPPHEDY
SWPYDDIIVFAFSCRAEEIQMYLCNKERYGYLNVPAKPHHTLEDDRLNFVHIHLESMIDG
PPMRQSRYVHMFPKQRDLMGFDEIYLINLRRRQDRRDRMLFSLNELEIDVKVVDAVDGNA
LNSSDIKILGVDLLPGYYDPFSGRTLTKGEVGCFLSHYFIWKEMVDEQMDKALVLEDDVR
FQANFKRRVLRLLEEVQQVELDWDIIYFGRKQVNPGNEKEVENVRNLVYADYSYWTLSYA
ISLQGAQKLLNAEPLSKMLPVDEFLPIMYDKHPNDAYKSHFPNRNLQAFSTRPLVVQPCH
YAGDPDWVSDTETSTLWDDDSVRTDWRGSHKTLKGAAPPPEMLSAAYKDEL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgctcctgctggcgttagcggccctgctcctccaggcagactcctacttctcc
gaggaaaagtatccggaggagtcgaaggtgcagcctcccaccgtggtgatcgcgatcata
gcccgcaacaccgctcactccctgccctactacctcggagccctggagagactcaactac
cccaaagagcgcatctccgtgtgggcggccacggatcacaactctgacaacaccacagcc
atgttgaaagagtggctcaccttcacacagaagttttaccattatgtcgagtggagaccc
atggatcagcccacgtcctatgcaggagagctgggtcctaagcactggcccaacagcaga
tacgagtatgtgatgaagctgaagcaagcagcactgaacttcgcccggaaacgctgggcc
gactacatcctgtacgttgacactgacaatatcctcaccaacccagaaacactcaacctg
atgatcgcagaaaacaagtctgtcatcgctcccatgttagactctcagggagcctactcc
aactactggtgcggcatcactccgcagggatactatcgtcgaacagccgagtatttcccc
acccgtcaccgtcacagactgggctgcttcccggtgcccatggtccactccactgtgctg
ctggatctaaggaaggagggcatgaagaacctggctttcttccctcctcacgaggactac
tcctggccctacgacgacatcatcgtgttcgccttctcctgtcgagctgaagagatacag
atgtacctgtgcaacaaggagcgctacggctacctgaacgtcccggccaaacctcaccat
accctggaggatgatcgcctcaactttgttcacatccaccttgagtccatgattgacggt
cctcccatgcgccagtctcgctatgtccacatgttccccaaacagagagacctcatgggt
tttgatgagatatatctgataaacctgcggcgccgtcaggaccgcagagaccggatgttg
ttctctctgaacgagctggagatcgatgtgaaggtggtggatgctgtggatggaaatgca
ctgaacagcagtgacattaagatcctgggtgttgacttgctaccgggctactacgacccg
ttctctggacgcaccctgactaaaggagaggtgggctgcttcctcagccactacttcatc
tggaaggagatggtggacgagcagatggataaagcgctcgtcttagaagacgatgtccgt
ttccaggccaacttcaaacgacgggtcctcagactattggaggaggtgcagcaggtggaa
ctcgactgggacatcatatactttggcaggaaacaggtgaatcctgggaacgagaaggag
gtggagaacgttcgtaacctggtgtacgccgactactcgtactggactctgtcttatgcc
atctctctgcaaggagcccagaaactgctcaacgctgaaccactttccaagatgctgcct
gtggatgagttcctccccatcatgtatgacaagcatcccaatgatgcctacaagtcccac
ttccccaacagaaacttacaagccttcagtacacgccccctcgtggtccagccgtgccac
tacgccggagatccggactgggtgagcgacacagagacgtccacgctgtgggacgatgac
tctgtacgcacagattggaggggctcccacaagaccctgaaaggagcggctccgccaccc
gagatgctgtcagctgcctacaaggatgaactttag

DBGET integrated database retrieval system