KEGG   Paralichthys olivaceus (Japanese flounder): 109627896
Entry
109627896         CDS       T06037                                 

Definition
(RefSeq) thrombospondin-1-like
  KO
K16857  thrombospondin 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04145  Phagosome
pov04350  TGF-beta signaling pathway
pov04510  Focal adhesion
pov04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109627896
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109627896
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109627896
  09143 Cell growth and death
   04115 p53 signaling pathway
    109627896
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109627896
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pov04131]
    109627896
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pov00536]
    109627896
   04990 Domain-containing proteins not elsewhere classified [BR:pov04990]
    109627896
Membrane trafficking [BR:pov04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109627896
Glycosaminoglycan binding proteins [BR:pov00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   109627896
Domain-containing proteins not elsewhere classified [BR:pov04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   109627896
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC TSP1_ADAMTS EGF_3 EGF_CA cEGF EGF Laminin_G_3 TSP1_CCN Laminin_G_2 hEGF
Other DBs
NCBI-GeneID: 109627896
NCBI-ProteinID: XP_019940276
LinkDB
Position
Unknown
AA seq 1258 aa
MESGKHIHPCKELQEMLLLIAVAQWAVHPCVMPPNGSTTGKCQSRDFGICKPKKAKQNAS
ASPLNMTQHITKRTSRLRRTSNEARLSVNTTLHERTVSLSVSLSHRELESRDDNSVYDLF
DLAQVSKRNHGVSVVKGADPYSPAYKVLNPDLIPPVPDSSFRDLLDSIQAERGFLLLLNL
KQFKRSRGSLLTIEKNDGSGPIFEVISNGKASTLDVVYSTMSQQQVVSIEDADLATGHWK
NITLFVQDDRVQLFVGCEEINVSELDVPIQKVLTQEVADIARLRIGKGAVKERFMGVLQN
VRFVFGTTLDAILRNKGCQSGASLSDVMTLDNPVNGSSPAIRTDFTGHKSKDVQSVCGLS
CEDITSMFKELKSLGVVVKQLSHKLSKVSEDSNLLMNQMKIHRGVCFHNGVVYKDKDEWT
VDGCTECTCQNSATVCRKISCPLIPCANATVPDGECCPRCGTQNYEEDGWSPWSEWTHCS
VTCGRGIQQRGRSCDRINSNCEGTSVQTRDCYPQECDKRFKQDGGWSHWSPWSSCSVTCG
EGVITRIRLCNSPTPQLGGRDCEGEGRQTEICQKSPCPINGGWGPWSPWDTCTVTCGGGV
QTRKRLCSDPVPKYGGKDCVGDATMSQLCNKQDCPIDGCLSSPCFSGAKCTSFPDGSFRC
GKCPLGYRGNGVICKDIDECKEVPDACHTHNGIHRCENTAPGYNCLPCPTRFSGLQPFGR
GVEQATAKKQVCMPRNPCQDGSHNCNKNAKCIYLGVYSESMFRCECKPGYAGNGRICGED
TDLDGWPNTDLLCVENATYHCKKDNCPNLPNSGQEDHDKDGLGDECDHDDDNDGIPDDRD
NCPRVYNPAQYDADRDDVGDSCDNCVFEANADQTDTDNNGEGDACAVDIDGDGILNENDN
CPYVYNVDQRDTDRDGVGDHCDNCPLEHNPDQIDSDSDLIGDKCDNNQDIDEDGHQNNLD
NCPYIPNANQADHDKDGKGDACDHDDDNDGIPDDKDNCRLAFNPDQLDSDGDGRGDVCKD
DFDQDNVLDIYDVCPENFAISETDFRRFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNC
DPGIAVGYDEFSAVDFSGTFFINTDRDDDYAGFVFGYQSSSRFYTVMWKQITQTYWSHTP
TRAQGYSGLSIKVVNSTTGPGEHLRNALWHTGDTSGQVRTLWHDPKNIGWKDFTAYRWHL
IHRPKTGLIRVVMYEGKRIMADSGNIFDKTYAGGRLGLYVFSQEMVYFSDLKYECRDT
NT seq 3777 nt   +upstreamnt  +downstreamnt
atggagtctggaaaacatatacatccctgcaaggagctccaggagatgctgctgctcatt
gctgtggcccagtgggcagtgcacccctgtgttatgcctcccaatgggagcaccaccgga
aagtgtcagtcacgagactttggcatctgcaaaccgaagaaagcaaaacaaaacgcttct
gcttctccacttaacatgacacagcacattaccaagcggacaagtcgactgcgcaggacc
tccaatgaggctcgactgtctgtaaacacaacactgcacgagaggactgtcagcctcagt
gtttccttgagccacagagagcttgagagtcgtgatgataacagtgtgtacgacttattt
gacctggcacaagtcagcaagagaaaccatggggtgagcgtggtgaagggtgcagacccc
tacagccctgcatacaaggtcctgaacccagacctgatcccccctgtcccagacagctcc
ttcagggacctcctcgactccatccaggccgagaggggcttcctcctcctcctcaacctc
aagcagtttaagaggagccgcggcagcctcctcaccatcgagaagaacgacgggtccgga
ccaatctttgaggtcatctccaatggcaaggcaagcaccctcgacgtggtctactccacc
atgagccagcaacaggtggtgtcaatcgaggacgcagacttggcaaccggacactggaag
aacatcacgttgtttgtgcaggatgaccgcgttcagctctttgtcggctgtgaggagatc
aacgtgtcagagctggacgtgcccatccagaaggtgctgacccaagaggtggcagacatc
gccaggctcaggattggaaagggagctgtgaaggagagattcatgggagtccttcagaat
gtgcgctttgtctttgggacaactcttgatgccatactgagaaataaaggttgccagagt
ggagcatctttatctgatgtcatgaccttggacaacccagtcaacggctccagtcctgcc
attaggactgatttcaccggccacaaatccaaagatgtgcagtctgtctgtggcctctcc
tgtgaggacatcaccagcatgtttaaggagctcaagagtctcggtgtagttgtcaaacag
ctgtcgcacaagctcagcaaagtgtctgaggacagcaatctgctgatgaatcaaatgaag
atccacagaggagtttgcttccacaatggagtcgtgtacaaggacaaagatgaatggact
gtggacggctgcactgagtgcacctgccagaactctgctactgtgtgtcgcaaaatctcc
tgccctctgatcccatgtgctaatgccaccgtgcccgatggagagtgctgccctcgctgt
ggaacacagaactatgaggaggatggatggtctccctggtctgaatggacccattgttca
gtgacttgtggccgtggcatccagcaacgtggacgctcgtgtgaccgcatcaacagcaac
tgtgagggcacctctgtccagacccgtgactgctatcctcaggaatgtgacaaacgcttc
aaacaggatggtggttggagtcactggtccccctggtcatcatgctctgtgacctgtggt
gagggggtcatcacccggatccgcctctgtaactctcccacgccccagttgggtggcagg
gactgcgagggagaaggacgtcagactgaaatatgccagaagtcgccttgccctatcaat
ggaggttggggaccttggtcaccatgggacacctgcactgttacctgtggtggaggagtt
cagacccgcaaacgtctctgctctgaccctgtccccaaatatggtggaaaagactgtgtt
ggtgatgccaccatgtctcaattgtgcaacaaacaggactgtcctattgatggttgtctg
tccagcccatgcttctcaggcgcaaagtgcaccagcttccctgatggttctttcaggtgt
ggcaaatgtccactcggctatcgtgggaatggcgtcatctgcaaggatattgatgagtgt
aaagaagtacctgatgcttgccacactcataacggaatccatcgctgtgagaatactgcg
cctggttacaactgtttgccttgccccacacgtttctctggccttcagccctttggaaga
ggagtggaacaggcaactgctaaaaaacaggtttgcatgcctcgtaacccttgccaggat
ggtagccataactgcaataaaaatgcaaaatgcatctacttgggtgtctactccgagtcc
atgttccgctgcgagtgcaagccaggatacgccgggaatggccggatctgtggcgaggat
actgacctggatggatggcccaacactgacctgctgtgtgtggagaatgctacctaccac
tgcaagaaggataactgccccaaccttcccaactctggtcaggaagaccatgacaaagat
ggcctgggtgatgaatgtgaccatgatgatgacaatgatgggatccccgatgatagggac
aactgcccaagagtgtacaaccctgcccagtacgacgcagacagggatgatgttggcgac
agttgtgacaactgtgtttttgaggccaatgccgaccaaaccgacactgacaacaatgga
gagggtgatgcctgtgctgtggacattgatggcgatggcattctgaatgagaacgacaac
tgcccttatgtttacaatgtggaccagagagatactgatagggatggtgtgggagaccat
tgtgacaactgccctctggagcacaatcctgatcagatcgactctgactcagatctcata
ggagacaagtgcgacaacaaccaggacattgacgaggatggtcaccagaacaacttggac
aactgcccctatatccctaatgccaaccaggcggaccatgacaaggatggcaagggtgac
gcctgcgaccatgacgacgacaatgacggcatacccgatgacaaagacaactgtcgactg
gcctttaaccccgatcaactggattctgatggtgatggccgtggtgatgtttgcaaagac
gattttgatcaagacaatgttctggacatctatgacgtgtgtccggaaaactttgccatc
agcgaaacagacttccgcagattccagatggttcctctggaccctaagggtacctcccag
attgatcccaactgggtggtccggcatcagggcaaagagttggtccagacagtcaactgt
gatcctggcattgctgttggttatgatgagttcagtgcagtggatttcagcggaacattc
ttcatcaacacggacagagatgatgattatgctgggtttgtgtttggctaccagtccagc
tcgcgcttctacacggtcatgtggaagcagatcacgcagacctactggtcccacacaccc
acaagagctcaaggctactctggcctgtcaatcaaagtggtcaactccaccactggccct
ggtgagcacctgaggaatgccttgtggcacaccggtgacacctcaggacaggttcgcact
ctgtggcacgaccccaagaacattggctggaaggacttcactgcctacaggtggcacctg
atccatagacccaagactggacttatcagagtggtcatgtatgaaggcaagagaatcatg
gccgattctggaaacatctttgacaagacatacgctggtgggcgactaggcttgtacgtc
ttctctcaggagatggtttatttctcagacctaaaatatgaatgcagagatacataa

KEGG   Paralichthys olivaceus (Japanese flounder): 109636170
Entry
109636170         CDS       T06037                                 

Definition
(RefSeq) thrombospondin-1-like
  KO
K16857  thrombospondin 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04145  Phagosome
pov04350  TGF-beta signaling pathway
pov04510  Focal adhesion
pov04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109636170
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109636170
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109636170
  09143 Cell growth and death
   04115 p53 signaling pathway
    109636170
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109636170
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pov04131]
    109636170
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pov00536]
    109636170
   04990 Domain-containing proteins not elsewhere classified [BR:pov04990]
    109636170
Membrane trafficking [BR:pov04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109636170
Glycosaminoglycan binding proteins [BR:pov00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   109636170
Domain-containing proteins not elsewhere classified [BR:pov04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   109636170
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_CA EGF_3 TSP1_ADAMTS Laminin_G_3 cEGF EGF TSP1_CCN
Other DBs
NCBI-GeneID: 109636170
NCBI-ProteinID: XP_019953313
LinkDB
Position
Unknown
AA seq 1169 aa
MKLTGIFLLLMVWSCEAARVAESRDDNSVHDLFDLIQVPKKNHGVTLVKGDDPYSPAYKI
LNPDLIPPVPESAFRDLIDSIHAERGFLLLLNFKQFKRTRGSLLTVEKKDGSGPVFEIVS
NGKANTLDIVFSTENKQQVVSIEDVDLATGHWRNITLFVQEDRAVLYAGCDEVNTAELEA
PIQSILTHETPASAQLRIGKGAVKDRFMGVLQNVRFVFGTTLDAILRNKGCQNSITSDTM
ILENLNGSSAIRTEYTGHKTKDLQMVCGFSCEDLVGMFKELKSLGVVVKELSNELRQLTD
ENKLIKSHIDIHSGVCIHNGIVHKNKDEWTVDDCTECTCQNSATVCRKISCPLISCANAT
IPDGECCPRCGTPSDYAEDGWSPWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSVQTR
DCYLQECDKRFKQDGGWSHWSPWSSCSVTCGSGVITHIRLCNSPNPQLGGKDCVGEGRQT
EKCQMDPCPINGNWGPWSPWDTCSLTCGGGVQTRKRLCNDPAPKYGGKECVGEAKVTQIC
NKKACPIDGCLSNPCFAGAKCTSFPDGSWKCGKCPAGYSGNGIKCKDVDECQEVPDACFE
FNGVHRCENTEPGYNCLPCPPRYSGPQPFGRGVEHAAAHKQVCTPRNPCLDGSHDCNKNA
RCNYLGHFADPMYRCECRPGYAGNGHICGEDTDLDGWPNADLVCVENATYHCKKDNCPNL
PNSGQEDYDKDGIGDACDNDDDNDGIPDDRDNCPFIFNPRQYDYDRDDVGDRCDNCPYDS
NPDQTDTDNNGEGDACAVDIDGDGILNEKDNCPYVYNVDQRDTDLDGVGDMCDNCPLEHN
PDQVDSDDDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDDDND
GIPDDKDNCRLAFNPDQLDTDGDGRGDACKDDFDQDNVPDIYDVCPENFGISETDFRQFQ
MVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYHEFNAVDFSGTFFINTERDDD
YAGFVFGYQSSSRFYVVMWKQITQTYWSNKPTKAQGYSGLSIKVVNSTTGPGEHLRNALW
HTGNTPGQVRTLWHDPKNVGWKDFTAYRWHLIHRPRTGHIRVVMYEGKKIMADTGSIYDK
TYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3510 nt   +upstreamnt  +downstreamnt
atgaagctcacggggatatttttgttgttgatggtttggagctgcgaggctgcgagagtc
gcagagagcagagacgacaatagcgtgcacgacttgtttgatctcatccaagtccccaag
aagaaccacggggtcaccctggtgaaaggagacgacccgtacagccccgcctacaagatc
ctcaacccggacctgatccccccggtccccgagagcgcctttagggacctcatcgactcc
atccacgccgagagaggattcctcctgctgctcaacttcaagcagttcaagcggacccgg
gggagcctcctgaccgtggagaagaaggacggctccggacccgtgtttgagatcgtctcc
aacggcaaggcgaacaccttggacatagttttctccaccgagaacaagcagcaggtggtg
tccatcgaggatgtggatctggccacgggtcactggaggaacatcaccctgttcgtgcag
gaggaccgggcggtgctgtacgcgggatgcgacgaggtgaacaccgcggagctggaagcg
cccatccagagcatcctgacgcacgagactccggccagcgcgcagctccggattgggaag
ggagcggtgaaggacaggttcatgggggtcctacaaaatgtgcgctttgtgtttggaaca
actctcgatgccatcctccgcaacaaaggatgccaaaactccataacatctgacaccatg
atcctggagaacctgaatggttcctcagccataagaacagagtacactggacataagacc
aaagacctgcagatggtctgtggcttctcctgtgaggacttggtcggcatgtttaaggag
ctgaagagcctcggtgtggtggtgaaggagctttccaatgagctccgacagctgacggat
gaaaacaaactgataaaatcccacatcgacattcacagtggcgtctgcatccacaacggc
atcgtgcacaagaacaaagacgagtggaccgtcgacgactgcaccgagtgcacttgtcag
aactctgctactgtgtgccgcaagatctcctgccccctgatctcctgtgccaacgctact
attcctgatggagagtgctgcccccgctgtggaacaccgagtgactatgcagaagacggc
tggtcgccgtggtctgaatggacccattgttccgtgtcatgtgggcggggcatccagcag
cgtgggcgctcctgcgaccgtatcaataacaactgtgagggcacctcagtgcagacccgt
gactgctacctccaggagtgtgacaaacgcttcaagcaggacggtggttggagccactgg
tcaccctggtcttcctgctccgtcacctgtggttctggtgtcatcacccacatccgcctc
tgcaactcccccaaccctcaacttggcggcaaagactgcgtgggagagggcagacaaaca
gagaaatgtcagatggatccgtgccccatcaatggcaactgggggccgtggtcaccatgg
gacacatgcagtcttacctgtggaggtggtgtccagactcgtaaacgcctgtgcaatgac
cctgcaccaaagtacggtggcaaagagtgtgttggtgaagccaaagtcacccagatatgc
aacaagaaagcctgccccatcgatgggtgtctgtccaatccctgctttgctggagcaaaa
tgcaccagtttccctgatggttcttggaaatgtggcaagtgtccagctggttacagcggc
aacggtatcaagtgcaaagatgtcgatgagtgccaagaggtgccagacgcttgctttgag
tttaatggtgtccatcgctgtgagaatacagaaccaggctacaactgtctgccctgccct
cctcgctactcaggaccccagccctttggcagaggtgtggagcatgctgcagctcacaaa
caggtgtgcacaccccgtaatccctgcctcgatggaagccatgactgtaataaaaacgcc
cgctgcaactaccttggacacttcgccgatcccatgtaccgctgcgagtgtaggcccggt
tatgctggcaatggccatatctgtggagaggacacggacctcgatgggtggcccaacgct
gacttggtttgtgtggagaatgccacctaccactgcaaaaaggacaactgccccaacctc
cccaactctgggcaggaagattacgataaggacggcattggagatgcttgtgacaatgat
gatgacaatgatggcattcctgacgatagggacaactgtccattcatcttcaaccccagg
cagtacgattatgatcgtgatgatgtgggtgaccgctgtgataactgcccctatgacagt
aatccagaccagacagacacagacaacaatggagagggagatgcctgtgctgtggacatc
gatggagatggtatattaaatgagaaggacaactgtccttatgtgtacaacgtcgaccaa
agagacacagatctggacggagttggagacatgtgtgataactgcccgctggaacataat
cctgatcaggtggattcagacgatgaccgtgtgggagacaagtgtgacagcaaccaggac
attgatgaggacggacatcagaacaatctagacaactgcccgtacatccccaatgccaat
caggctgaccatgacaaggacggcaagggagacgcctgtgaccacgatgatgacaatgat
ggcatccctgatgataaggacaactgcagactggccttcaaccctgaccaactggacact
gatggtgatggccgtggtgatgcttgcaaagatgacttcgaccaagacaacgtgcctgac
atctatgacgtgtgtcccgaaaactttggcatcagcgagacagacttccgccagttccag
atggttcctttggatcccaaaggcacctcccagattgatcctaattgggttgtgcgccat
cagggcaaagagctcgtccagactgtcaactgcgaccctggcattgctgttgggtaccat
gagtttaatgcagtggacttcagtgggaccttcttcatcaacacagagagggatgatgac
tatgccggctttgtgtttggctaccagtccagttccaggttctatgtggtgatgtggaag
cagattacgcagacctactggtcaaataaacccaccaaggcccaggggtactccggcctg
tccattaaagtggttaattccactactggtcctggagagcacctccgaaacgccctctgg
cacaccgggaatacccctggacaggtccgcaccctatggcatgacccaaagaatgttgga
tggaaagacttcactgcctacagatggcatctgatccacagaccaagaacaggacatatt
agagttgtgatgtacgagggcaagaagatcatggcagatactggtagcatctatgacaag
acatacgcaggtggcaggctaggtctttttgtcttctcacaagagatggtatacttttca
gacctcaagtatgaatgcagagatgcataa

DBGET integrated database retrieval system