KEGG   Paralichthys olivaceus (Japanese flounder): 109627930
Entry
109627930         CDS       T06037                                 

Gene name
siva1
Definition
(RefSeq) apoptosis regulatory protein Siva
  KO
K22744  apoptosis regulatory protein Siva
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109627930 (siva1)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 109627930
NCBI-ProteinID: XP_019940315
LinkDB
Position
Unknown
AA seq 170 aa
MPKRSCPFPETFSSQYKVHVRQQELNNFGVFGNKYRQEIYEKTKNLLFNGAKVVMDRIWT
GEEKSTDPQSAGPAETPACNQTLLRGQTLIGHDGRLTRVNAAPGTPAIPAGCCVCQKSQG
SRTPCSQCDRPVCSSCTRQCSSCSSFCCSVCTIIDYSGQYDEVLCCSCST
NT seq 513 nt   +upstreamnt  +downstreamnt
atgccgaagagatcgtgtccgttccctgagaccttctcctctcagtacaaagtacacgta
agacaacaggagctgaacaacttcggagtgttcgggaacaaataccggcaggaaatctac
gagaagacaaagaacttgctctttaacggagccaaggtcgtgatggacagaatctggacc
ggagaggagaagtccacggacccgcagtcagcaggaccagctgagacacccgcatgtaac
cagaccctgctgagaggacagactctgattggacacgatgggagactgacgagagtaaac
gctgcaccaggtacaccagcgattcctgcaggctgctgtgtttgtcagaagagccagggc
tccaggaccccgtgctcccaatgtgaccgcccagtgtgttcctcctgtacgcgacaatgc
tcgagctgctccagcttctgctgctccgtctgcaccatcatagattacagcggacaatat
gatgaagtactgtgctgcagctgctcgacataa

DBGET integrated database retrieval system