KEGG   Paralichthys olivaceus (Japanese flounder): 109628065
Entry
109628065         CDS       T06037                                 

Gene name
akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04012  ErbB signaling pathway
pov04068  FoxO signaling pathway
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
pov04261  Adrenergic signaling in cardiomyocytes
pov04370  VEGF signaling pathway
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04620  Toll-like receptor signaling pathway
pov04625  C-type lectin receptor signaling pathway
pov04910  Insulin signaling pathway
pov04914  Progesterone-mediated oocyte maturation
pov04920  Adipocytokine signaling pathway
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109628065 (akt1)
   04012 ErbB signaling pathway
    109628065 (akt1)
   04370 VEGF signaling pathway
    109628065 (akt1)
   04371 Apelin signaling pathway
    109628065 (akt1)
   04068 FoxO signaling pathway
    109628065 (akt1)
   04150 mTOR signaling pathway
    109628065 (akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109628065 (akt1)
  09143 Cell growth and death
   04210 Apoptosis
    109628065 (akt1)
   04218 Cellular senescence
    109628065 (akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109628065 (akt1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109628065 (akt1)
   04625 C-type lectin receptor signaling pathway
    109628065 (akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109628065 (akt1)
   04920 Adipocytokine signaling pathway
    109628065 (akt1)
   04914 Progesterone-mediated oocyte maturation
    109628065 (akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109628065 (akt1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109628065 (akt1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109628065 (akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109628065 (akt1)
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109628065 (akt1)
Protein kinases [BR:pov01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   109628065 (akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Seadorna_VP7 FTA2 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 109628065
NCBI-ProteinID: XP_019940502
LinkDB
Position
Unknown
AA seq 474 aa
MTNVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQTVAEGLQKQEEEMMDS
SPDPMDMEVYLTKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERARFYGAEIVSALDYLHSERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIR
FPRTLGPEARSLLSGLLKKDPMQRLGGGPDDAKEIMQHKFFAGIEWQDVYEKKLVPPFKP
QVTSETDTRYFDEEFTAQTITITPPGQADDSMESFDSEQRPHFPQFSYSASGTA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaccaatgtggtgatcgtcaaggagggatggctccataaaagaggagaatacatcaag
acctggaggccaaggtattttctcttgaagagcgatggtacgttcattggctacaaagag
cgaccgcaagatgttgaccagctggaaacacccttaaataacttctctgtagcacagtgc
cagctgatgaagacggaacggcccaagcccaacacatttatcatccgctgcctgcagtgg
accactgtcatcgagcgcaccttccacgtggagacccctgaggagagggaagaatggacg
aaagccatccagacagtggctgagggtctacagaaacaagaggaggagatgatggactcc
tctccagaccccatggacatggaggtctaccttaccaaacctagactaaaagtgactatg
cacgactttgaatacctcaaactcctgggaaaaggcacttttggcaaagttatcctggta
aaggagaaggccacaggacgctactacgccatgaagatcctaaagaaggaagtgatcgta
gcaaaagatgaagtggcgcacactctcacagagaacagagtcctccagaattcaaagcat
ccgttcttgacaggactgaaatactccttccagacacatgaccgcctgtgctttgtcatg
gagtatgcaaacggtggcgagcttttcttccacttgtcaagagaccgggtattctcggag
gagcgggcacggttttacggtgcagagatagtgtcggcgctggactaccttcattctgaa
agaaacgtggtctatcgagatctaaagctggaaaacctcatgctggacaaagatggacac
ataaagatcaccgactttggtctgtgtaaggagggaatcaaggatggtgcaaccatgaaa
acattctgtgggacaccagagtacctcgcacctgaggtgctagaagacaacgactacggc
cgtgcagtggactggtggggtctgggtgtggtgatgtacgagatgatgtgcggccggctg
cctttctacaaccaggaccacgagaagctgttcgagctcatcctcatggaagacatccgc
ttcccacggacgcttggacccgaagcgcgctctctgctgtctggccttctcaagaaagac
ccaatgcagaggttaggtggagggcctgacgatgccaaggaaatcatgcagcacaagttc
ttcgcgggaatcgaatggcaggacgtttatgagaagaagctggtcccgccatttaagccc
caagttacctcggaaacagacacgcgatattttgacgaggagttcacagcacagaccatc
actatcacaccacccggacaagcagatgacagtatggagtccttcgacagcgagcagaga
ccccacttcccccagttctcctactctgccagcgggacggcctga

KEGG   Paralichthys olivaceus (Japanese flounder): 109630907
Entry
109630907         CDS       T06037                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04012  ErbB signaling pathway
pov04068  FoxO signaling pathway
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
pov04261  Adrenergic signaling in cardiomyocytes
pov04370  VEGF signaling pathway
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04620  Toll-like receptor signaling pathway
pov04625  C-type lectin receptor signaling pathway
pov04910  Insulin signaling pathway
pov04914  Progesterone-mediated oocyte maturation
pov04920  Adipocytokine signaling pathway
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109630907
   04012 ErbB signaling pathway
    109630907
   04370 VEGF signaling pathway
    109630907
   04371 Apelin signaling pathway
    109630907
   04068 FoxO signaling pathway
    109630907
   04150 mTOR signaling pathway
    109630907
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109630907
  09143 Cell growth and death
   04210 Apoptosis
    109630907
   04218 Cellular senescence
    109630907
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109630907
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109630907
   04625 C-type lectin receptor signaling pathway
    109630907
  09152 Endocrine system
   04910 Insulin signaling pathway
    109630907
   04920 Adipocytokine signaling pathway
    109630907
   04914 Progesterone-mediated oocyte maturation
    109630907
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109630907
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109630907
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109630907
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109630907
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109630907
Protein kinases [BR:pov01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   109630907
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C APH Seadorna_VP7
Other DBs
NCBI-GeneID: 109630907
NCBI-ProteinID: XP_019944974
LinkDB
Position
Unknown
AA seq 563 aa
MSDVTIVREGWLQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDSPDERDEWTEAIQMVADKLQRQEEERIQCS
PTSNIDNMVEEEMDISTTQHKRKTMSDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEERTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPELFFHLSRERVFSEERTRFYGAEIVSALDYLHSAKIVYRDLKLEN
LMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVT
YEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDA
KEIMRHSFFTGVDWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITVTPPEKFDEDG
MDCLDNERRPHFPQFSYSASGRE
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgttagagagggatggctccagaaacggggtgaatacataaag
aactggcgaccgcgttacttcctgttgaagacagacggctccttcatcggctacaaagag
aaacctcaggacgcagacctgccctacccactaaataacttttctgtagcaaaatgtcag
ctgatgaagacagagaggccaaagccgaacaccttcatcatacgctgcctccagtggacc
acagtcatcgagaggaccttccacgtggactcgcctgatgagagagatgagtggacagag
gccatccagatggtcgctgacaagctgcagagacaagaggaggagaggatccagtgcagc
cccacctccaatatcgacaacatggtcgaggaggagatggacatctctaccacacaacac
aaacgcaagacaatgagtgacttcgactacctgaagctgctgggaaagggaacctttggc
aaagtgattctggtccgagaaaaggccagtgggaaatattatgccatgaaaatccttaaa
aaagaagtgatcatagccaaggatgaagtggctcacacactcacagagagcagagtactg
aaaaacaccagacatccctttctcacctcattgaagtattcattccagactaaagaccgc
ctctgtttcgtcatggagtatgtgaatggaggagagctgtttttccatttgtccagagag
cgggtgttctcggaggagcgcacgcgcttctacggcgccgagatcgtctcagctctagac
tacctgcattccgccaagattgtgtaccgggacctcaagttggaaaacctgatgctggat
aaagatggccatatcaagatcactgattttggcctctgcaaggagggtatcacagacgct
gctaccatgaagaccttctgtggcactccagagtacctagcaccagagctgtttttccat
ttgtccagagagcgggtgttctcggaggagcgcacgcgcttctacggcgccgagatcgtc
tcagctctagactacctgcattccgccaagattgtgtaccgggacctcaagttggaaaac
ctgatgctggataaagatggccatatcaagatcactgattttggcctctgcaaggagggt
atcacagacgctgctaccatgaagaccttctgtggcactccagagtacctagcaccagag
gtcctggaggacaacgactacggtcgggcggtggactggtggggtttgggtgtggtgacg
tacgagatgatgtgcggccgactgccgttctacaaccaggaccacgagaagctgttcgag
ctcatcctcatggaggacatcaagttccctcgcactctgtcatccgacgcaaagtcgctg
ctgtccggcctgctcatcaaagaccccaacaaacggctcggtggaggaccagatgatgct
aaagaaataatgagacacagtttcttcactggtgttgactggcaggacgtctacgataaa
aagctcgtcccgcccttcaagcctcaggtgacgtcggagacagacaccagatactttgac
gaggagttcacagcccagaccatcaccgtcactccaccagagaaatttgacgaggacggg
atggactgtctggacaacgagagacggccgcacttcccacagttctcctactcggccagc
gggcgggaatga

KEGG   Paralichthys olivaceus (Japanese flounder): 109634602
Entry
109634602         CDS       T06037                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04012  ErbB signaling pathway
pov04068  FoxO signaling pathway
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
pov04261  Adrenergic signaling in cardiomyocytes
pov04370  VEGF signaling pathway
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04620  Toll-like receptor signaling pathway
pov04625  C-type lectin receptor signaling pathway
pov04910  Insulin signaling pathway
pov04914  Progesterone-mediated oocyte maturation
pov04920  Adipocytokine signaling pathway
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109634602
   04012 ErbB signaling pathway
    109634602
   04370 VEGF signaling pathway
    109634602
   04371 Apelin signaling pathway
    109634602
   04068 FoxO signaling pathway
    109634602
   04150 mTOR signaling pathway
    109634602
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109634602
  09143 Cell growth and death
   04210 Apoptosis
    109634602
   04218 Cellular senescence
    109634602
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109634602
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109634602
   04625 C-type lectin receptor signaling pathway
    109634602
  09152 Endocrine system
   04910 Insulin signaling pathway
    109634602
   04920 Adipocytokine signaling pathway
    109634602
   04914 Progesterone-mediated oocyte maturation
    109634602
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109634602
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109634602
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109634602
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109634602
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109634602
Protein kinases [BR:pov01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   109634602
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11
Other DBs
NCBI-GeneID: 109634602
NCBI-ProteinID: XP_019950786
LinkDB
Position
Unknown
AA seq 482 aa
MNEVSVVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPEVSSDHSLPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTSVIERTFHVDSNDEREEWMRSIQAVANSLKSQQQDEEP
MEIKFGSPTDSSGTEEMEIAMSKSNTKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFF
HLSRDRVFTEDRARFYGAEIVSALEYLHSRNVVYRDLKLENLMLDKDGHIKITDFGLCKE
GITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEEIRFPKNLAPEAKALLAGLLKKDPKQRLGGGPDDAKDVMSHKFFTSINWQDVTE
KKLIPPFKPQVTSETDTRYFDDEFTAQTITITPPDKYDSLDPEDSDQRTHFPQFSYSASI
RE
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgaatgaagtcagtgttgtgagagagggatggctccacaagagaggtgaatacattaaa
acttggcgtcctcgctacttcatattaaagagtgatggctccttcattggctacaaagag
aagcctgaggtgtccagtgaccacagcctcccaccgctcaacaatttctctgtcgcagaa
tgccagctgatgaagacagagcgtccgaggcccaacacgtttgttattcgttgcctgcag
tggacttcggttatcgaacggaccttccatgtggatagcaacgatgagagggaggagtgg
atgcgatcgatccaggcggtggcaaatagcctgaagagtcagcagcaggatgaggagccc
atggagatcaaatttggctctccaactgacagcagcggcacagaggagatggagattgct
atgtccaagtccaacacaaaagtgaccatgagtgatttcgactacctgaagctgctgggc
aaagggacgtttggtaaagtgattctggtgaaggaaaaggccacagggatgtactacgcc
atgaaaatcctccgtaaagaagtcatcattgctaaagatgaagtggcacacacagttact
gaaagcagagtactccaaaacacacggcatccctttctaacaacactaaaatatgcattt
caaacacatgaccggctatgctttgtgatggagtatgcaaatggaggagaactattcttt
cacttatcgcgggacagagtgttcacagaagacagagcacgattctatggtgcagaaata
gtatcagcactggagtacctacactcacgcaatgttgtttacagggatttgaaactggag
aacctcatgttagacaaggacggccacataaagataactgactttgggttgtgtaaagag
gggatcacagatggagccaccatgaaaaccttctgtggaaccccagagtacctggcacca
gaggtgcttgaggacaacgactacggacgagcggtggactggtggggactgggcgtggtc
atgtatgaaatgatgtgtggtcggttgcccttctacaaccaggaccacgaacgtctcttt
gagctcatccttatggaggaaatccgcttccccaagaacctagcccctgaagccaaggcc
ctgctggctggcctgcttaaaaaggatcctaaacaaaggctcggaggtggaccagacgat
gccaaagatgtgatgagccacaagttcttcacctccatcaactggcaagatgtcactgaa
aaaaagcttattccaccatttaagccccaggtaacatcagagacagacacacgctacttt
gatgatgagttcacagcacaaaccatcacgataactcctccagataagtatgacagttta
gatccagaggattcagatcagcgtacgcacttccctcagttctcctactctgccagcata
cgggaatga

KEGG   Paralichthys olivaceus (Japanese flounder): 109641589
Entry
109641589         CDS       T06037                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04012  ErbB signaling pathway
pov04068  FoxO signaling pathway
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
pov04261  Adrenergic signaling in cardiomyocytes
pov04370  VEGF signaling pathway
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04620  Toll-like receptor signaling pathway
pov04625  C-type lectin receptor signaling pathway
pov04910  Insulin signaling pathway
pov04914  Progesterone-mediated oocyte maturation
pov04920  Adipocytokine signaling pathway
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109641589
   04012 ErbB signaling pathway
    109641589
   04370 VEGF signaling pathway
    109641589
   04371 Apelin signaling pathway
    109641589
   04068 FoxO signaling pathway
    109641589
   04150 mTOR signaling pathway
    109641589
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109641589
  09143 Cell growth and death
   04210 Apoptosis
    109641589
   04218 Cellular senescence
    109641589
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109641589
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109641589
   04625 C-type lectin receptor signaling pathway
    109641589
  09152 Endocrine system
   04910 Insulin signaling pathway
    109641589
   04920 Adipocytokine signaling pathway
    109641589
   04914 Progesterone-mediated oocyte maturation
    109641589
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109641589
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109641589
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109641589
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109641589
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109641589
Protein kinases [BR:pov01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   109641589
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 109641589
NCBI-ProteinID: XP_019961656
LinkDB
Position
Unknown
AA seq 479 aa
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKSDGSFIGYKDKPQDSDLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVAESLAKQEEEGILCS
PTSQIENVNEEEMDTSISHYKRKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDT
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILM
EEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFGTIDWQDVYDKKLVP
PFQPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMDAADNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgaccagaacgtcgtcaaggaaggctgggtccagaaaagaggtgagtacatcaag
aactggcgaccgcgctacttcctgctgaagtcggacggctctttcatcggctacaaggac
aaaccacaggactcggacttggcctatccgctcaacaacttctctgtagcaaaatgtcag
ctgatgaagacggagcggcccaagccaaacaccttcatcatccgctgtctgcagtggacc
accgtcatcgagaggacttttcacgtggacacgcccgacgagagggacgagtgggccgag
gccattcagatggtcgcagagtctctggccaaacaggaggaggagggaatcctgtgcagc
cccacctcccagatcgagaacgtcaacgaggaggagatggacacgtccatcagccactac
aaacgaaagacaatgaacgactttgactatctgaagcttctgggcaaaggcacttttggg
aaagtcattctggtgagggagaaggcgagcggcacctactacgccatgaagatcctgaag
aaagaagtcataatagccaaggatgaagtcgctcacacactaacagaaagtagagtatta
aaaaatacccggcatccattcctaacttctctgaagtactcgttccagacgaaggatcgg
ctgtgctttgtgatggagtacgtcaacggaggagagttgtttttccacttgtcaagagag
agagtattttcagaggaccgcacccgtttctacggcgccgagatcgtctcagctctagac
tacctacattctgccaagatcgtttatcgtgatctgaagctggagaacctcatgttggac
aaagacggtcacatcaagatcaccgacttcggcctgtgcaaagaaggcatcaccgacact
gccaccatgaagacgttctgcggaacaccagaatacctggctcctgaggtgttggaggac
aacgactacgggcgggcggtggactggtggggtttgggcgtggtgacgtatgaaatgatg
tgcggccggctgccgttctacaaccaggaccacgagaagctgtttgagctcatcctcatg
gaggagatcaagttcccacgaaccctgtcagccgacgccaagtcgctgctgtcgggactg
ctcatcaaggaccccaacaaacgactgggcggcggaccggatgacgcgaaggagatcatg
cgacacagtttctttggcacaatcgactggcaggacgtctacgacaagaagctcgtccca
cctttccagccccaggtcagctcggagacggacacgcgctacttcgacgaggagttcaca
gcacagaccatcaccatcactccgccagaaaaatacgatgaggacgggatggatgcagcg
gacaacgagcggaggcctcatttcccacagttctcctactcagccagcgggcgggagtga

KEGG   Paralichthys olivaceus (Japanese flounder): 109642071
Entry
109642071         CDS       T06037                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04012  ErbB signaling pathway
pov04068  FoxO signaling pathway
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
pov04261  Adrenergic signaling in cardiomyocytes
pov04370  VEGF signaling pathway
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04620  Toll-like receptor signaling pathway
pov04625  C-type lectin receptor signaling pathway
pov04910  Insulin signaling pathway
pov04914  Progesterone-mediated oocyte maturation
pov04920  Adipocytokine signaling pathway
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109642071
   04012 ErbB signaling pathway
    109642071
   04370 VEGF signaling pathway
    109642071
   04371 Apelin signaling pathway
    109642071
   04068 FoxO signaling pathway
    109642071
   04150 mTOR signaling pathway
    109642071
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109642071
  09143 Cell growth and death
   04210 Apoptosis
    109642071
   04218 Cellular senescence
    109642071
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109642071
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109642071
   04625 C-type lectin receptor signaling pathway
    109642071
  09152 Endocrine system
   04910 Insulin signaling pathway
    109642071
   04920 Adipocytokine signaling pathway
    109642071
   04914 Progesterone-mediated oocyte maturation
    109642071
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109642071
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109642071
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109642071
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109642071
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109642071
Protein kinases [BR:pov01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   109642071
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11
Other DBs
NCBI-GeneID: 109642071
NCBI-ProteinID: XP_019962281
LinkDB
Position
Unknown
AA seq 480 aa
MNEVNIVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPDLNDQISPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSNEEREEWMRAIQSVANSLKMREQEEEEP
MDLFGSPSESSLEEMEVAMSKCRSKVTMSDFEYLKLLGKGTFGKVILVKEKSTGVHYAMK
ILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFHL
SRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
TPDATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFEL
ILMEEIRFPRNLSPEAKSLLAGLLKKDPKQRLGGGPNDAKEVMTHKFFITINWQDVVQKK
LTPLFRPQVTSETDTRYFDEEFTAQTITLTPPDKYNSLDCEDPAQQAHFPQFSYSASIRE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaatgaagttaatattgtcagagagggctggctccacaaaagaggtgaatatattaaa
acatggaggcccaggtatttcatcctgaagagtgacggttccttcattggctacaaggag
aagcctgacctaaatgaccagatttcacctccactcaataacttctcagtggcagaatgc
cagttaatgaagacagaaagaccccggcccaacacatttgtcattcgttgcctacagtgg
accactgttattgaacgcacctttcatgtggatagcaatgaggagagagaggagtggatg
cgtgctatccagtctgtggcaaacagtttaaaaatgcgagaacaggaggaggaggaacca
atggatctgtttggctcacccagtgagagcagcctggaggagatggaggtggctatgtcc
aagtgccgcagcaaagtgacaatgagtgattttgagtacctgaagctgcttggcaaaggg
acgtttgggaaggtgattctggtcaaagagaagtccactggagttcactatgccatgaaa
atactgcgcaaagaggtcataatagccaaggatgaggtggcccacacagtaacagagagc
agagtgttacaaaacacacgacatcccttcctcacgacactgaaatatgcgtttcaaacc
cacgatcggctctgttttgtaatggagtatgcaaacggaggcgagctcttctttcacttg
tcacgagaacgggtattcacagaagaccgggcacgcttctatggtgctgagattgtgtca
gcgcttgagtacctgcattcacgtgatgtagtgtaccgtgatctaaagctggagaatcta
atgctggacaaagatggccacatcaaaatcactgattttggcctttgtaaggagggtatt
actccagatgccacaatgaaaaccttctgtggaactcctgaatatcttgcacctgaggtc
ctagaggataatgactacggccgcgcagttgactggtggggtctgggtgtagtaatgtat
gagatgatgtgtggacgtctgcctttctacaaccaggaccatgagcgtctgtttgagctc
atcctcatggaggagatccgcttccccaggaacctgtcgcctgaggccaagtccctgctg
gctggactgctcaagaaggaccctaaacagaggttaggtggaggtcctaatgatgccaaa
gaagtaatgactcacaaatttttcatcaccatcaactggcaagatgtggtacagaagaag
cttaccccactcttcagaccacaagtgacatcagagacagacacccggtactttgatgaa
gaattcacggcacagaccatcacgctcactcctccagacaaatataacagtctggactgt
gaggatcctgcccaacaagcacacttcccccagttctcctattctgctagcataagagag
tga

DBGET integrated database retrieval system