KEGG   Paralichthys olivaceus (Japanese flounder): 109628292
Entry
109628292         CDS       T06037                                 

Gene name
chek1
Definition
(RefSeq) serine/threonine-protein kinase Chk1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109628292 (chek1)
   04115 p53 signaling pathway
    109628292 (chek1)
   04218 Cellular senescence
    109628292 (chek1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109628292 (chek1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pov03400]
    109628292 (chek1)
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109628292 (chek1)
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   109628292 (chek1)
DNA repair and recombination proteins [BR:pov03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109628292 (chek1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH LEAP-2
Other DBs
NCBI-GeneID: 109628292
NCBI-ProteinID: XP_019940880
LinkDB
Position
Unknown
AA seq 461 aa
MAVPFVQDWDLVQTLGEGAYGEVRLLVNRQTEEAVAVKVIDTSQAKECAENVKKEVCVHK
ILNHPNIVRFFGHRKEGPTVYLFLEYCTGGELFDRIEPDVGMAEKDAHMFFQQLIAAVEY
LHSIGITHRDIKPENILLDDKDNLKLTDFGLATMFRFKGRERPLNRLCGTLPYVAPELLS
RPEYKAQPADIWACGIVLTAMLAGELPWDQPTESCQEFSDWVQKKTYLPPWKKIQPMPLS
LLSKLLQVSPDARIAITEIKKDRWFTQGVKPPPASLGSGGNKHLRSDVGLKSRANSDDMM
QFSSSQPDLAAAGWEAMLLISQTDGQVSFSQPTKPEHMLLGSQLLGTPGASQSPWQRLVR
RMTRFFTTVNADASLSALKNTCESLALGFKLTCTKQVTLSTLDKRNNKLIFKVHLLEMNN
RVLLDFRLSKGDGLEFKRLFVKIKQKLGDIISTQKILLSVT
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggcggtgccttttgtgcaggactgggacctggtgcagacactgggagaaggagcctac
ggagaagtgaggctgctggtgaaccggcagacggaggaggcggttgcagttaaggtgatc
gatacctctcaggctaaagagtgcgctgaaaatgtcaagaaggaggtgtgcgtccataag
atcctcaaccaccccaacatcgtgcgtttttttggccatcggaaggaagggccgacggtg
tacctcttcctggagtactgcaccggaggagagctgttcgaccgaatcgagcctgacgtg
gggatggcagagaaagatgctcatatgtttttccagcagctaatagcagctgtggagtac
ctccacagtattggcatcacccacagagacataaagccagagaacatcttgctggatgac
aaagataacctgaagctgacagactttggcctggccaccatgtttcgtttcaaaggacga
gagcgtcctctgaatcgactctgtgggacacttccctacgtggccccggagcttctcagc
cgaccagagtacaaagctcagcctgctgatatttgggcttgtgggatcgtgctcactgcc
atgctggctggagagttaccatgggaccagcccactgagagctgtcaagagttttcagac
tgggttcaaaagaaaacttatctacctccttggaaaaaaatacaaccaatgccacttagt
ctgttgtccaaattactgcaggtgagtccagatgcacgcatcgccatcacagaaataaag
aaggatcgctggtttacacaaggtgtgaagcccccgccggcttctctgggttcaggagga
aacaaacatcttcgatcagatgtgggactaaaatccagagccaatagtgatgacatgatg
cagttttctagctctcagcctgatctcgcagcagctggctgggaagccatgttgttaatc
agtcagaccgacggacaagtcagcttctcccagccgaccaagccggagcacatgttgctg
ggtagtcagctactgggcacgccgggagccagtcagtctccttggcagagattagtgcgg
agaatgacacgcttcttcactaccgtgaacgccgacgcctcattatctgccctgaaaaac
acgtgtgaaagtctggcgcttggcttcaaactcacctgcaccaaacaggtgacattgagc
acactcgacaagcgcaataacaaactcatcttcaaagtccatttgctggagatgaataat
agagtgctgctggacttcagactgtctaagggcgacggtctggagtttaaacgactcttt
gtgaagataaaacagaagcttggtgacatcatcagcactcagaagattttactctcagtt
acatga

DBGET integrated database retrieval system