KEGG   Paralichthys olivaceus (Japanese flounder): 109628727
Entry
109628727         CDS       T06037                                 

Gene name
ppm1d
Definition
(RefSeq) protein phosphatase 1D isoform X1
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109628727 (ppm1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pov01009]
    109628727 (ppm1d)
Enzymes [BR:pov01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109628727 (ppm1d)
Protein phosphatases and associated proteins [BR:pov01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    109628727 (ppm1d)
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-GeneID: 109628727
NCBI-ProteinID: XP_019941597
LinkDB
Position
Unknown
AA seq 495 aa
MDDAIIFRMSAFSEQGGRKYMEDVVEIKIEYEPTAAPAEDHPKSQRQPDGGQLGGAEGEA
AGHTDTEARDERDVAAESGPASAMWVESLSNEESGDNNSGGGKAPEPAGKDAERVVDTRR
SVAFFAVFDGHGGREAAHFARDNLWELLKRQRGFWSKDHSEVCAALRKGFIACHHAMWKE
LPEWPKTITGLPSTSGTTASVIVIRGVHMYVAHVGDSAVVVGVKENESDITLQALEVTQD
HKPELPKEKERIERLGGSVMKKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARSLG
DLWSYDFYSGEFVVSPEPDTTVMTLDPKLHRYIILGSDGLWNMMPPKNAVNMCYSHDKMV
GPKGMSCARRLGCTALLFWKERMLRADNTTVIVLALQEHGGPPIPMHRDEIVVDMATGMD
HVPYPGTPYNTCEVPQLKYDGSQTPMVTQFPSEDHSFTKSLFCFRGQQAEHEDGMFYEED
EIYGEEHEDWTCLEW
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggacgacgcgataatattccgaatgagcgcgttctccgagcagggagggaggaaatac
atggaggatgttgtcgagataaaaatcgagtacgagccgacggcggcgccagcggaggat
catccaaagtcgcagcggcagcctgatggaggacagctggggggagcggagggcgaagcc
gccggacacaccgacaccgaggcgcgggatgaacgtgacgtcgccgccgaatctggtccc
gcttctgcgatgtgggtggagagtttatccaacgaggagagcggcgataacaacagcggc
ggcggtaaggcaccggaaccggccgggaaagacgcagagcgcgtcgtggacacgcgcagg
tccgtggcgttcttcgccgtgttcgacggtcacgggggccgggaagccgcacacttcgcc
cgggacaatctgtgggagctgctgaagaggcagcgcggcttctggtcgaaggatcacagc
gaggtgtgcgccgctctccgcaaaggcttcatcgcatgtcaccacgccatgtggaaggag
ctgccggagtggccgaagaccatcactggtctgcccagtacatcgggcaccacagccagc
gtgatcgtgatccgcggggttcacatgtacgttgctcatgtcggggactcagcggtagtg
gttggagtgaaagagaacgagtctgatatcacgctccaggcacttgaagtaacacaagac
cacaaacccgaactcccgaaagaaaaagagaggattgaacgactgggtggcagtgtaatg
aagaaatctggggtgaaccgtgtcgtgtggaagaggcctagactgacccataatggccct
gtgaggaggagcacagtcatcgaccagatccccttcctggctgtggcccgatcccttggt
gatctctggagctatgatttctacagcggggagtttgtggtgtcgccagagcctgatacc
actgtaatgacccttgaccccaagctgcatcgctacatcatccttggcagtgatgggcta
tggaatatgatgccacccaagaatgctgttaatatgtgttatagtcatgacaaaatggtg
gggccaaagggaatgtcttgtgcccgccggcttggatgcacagcgctactgttctggaaa
gaacgcatgctccgtgcagacaacacaacagttattgtcctggccctgcaggagcatggt
ggacctcctatccctatgcatcgagatgagatcgttgttgacatggccactggaatggac
catgttccatacccgggtactccttataacacatgcgaggtcccacagttaaaatatgat
ggttcacagacaccgatggtcacacagtttccgtccgaggaccactcgttcaccaaatca
ctcttttgttttcggggccaacaggcggagcatgaggatggcatgttttatgaagaagat
gagatatatggagaagaacatgaggattggacatgcctggagtggtag

DBGET integrated database retrieval system