KEGG   Paralichthys olivaceus (Japanese flounder): 109628832
Entry
109628832         CDS       T06037                                 

Gene name
ei24
Definition
(RefSeq) etoposide-induced protein 2.4 homolog
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109628832 (ei24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 109628832
NCBI-ProteinID: XP_019941807
LinkDB
Position
Unknown
AA seq 340 aa
MTDSVRAFLRNVATGIKDSILGIGTISKLDARIQQKREEQRRRRASGALAQRRAQSEERK
PDNDPKVASRIFQCCAWNGGVFWLSLFLFYRVFIPLLQTLTAKIIGDPSLHGSVWSWLEF
ILTSVFSALWVLPLFVLSKIVNAIWFQDIADLAFEVSGCKAQPFPSVSKIIADMLFNLLL
QALFLIQGMIVSLFPIDAIGQMVSLLHMSLLYSLYCFEYRWFNHGIEMHQRLSNIERNWP
YYFGFGLPMALLTALPSSYIISGCLFSILFPLFIISANEAKTPTKLYHFQLRLFSLVVLI
SNKLFHKTVHLQSSLTSSTSSERLSSPHTSPSRQRLVPNQ
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgacagacagcgtcagggccttcctccgcaatgttgcgacggggatcaaggactccata
ttggggattggaacaatctccaagctggatgcccgcatccagcagaaaagggaagagcag
cggaggagaagggctagcggggccctggcacagagaagggcacagagtgaagagcgcaaa
ccagacaatgaccccaaagtagccagcaggatttttcaatgctgtgcctggaatggagga
gtgttctggctcagtctgtttctcttctaccgggtgtttatcccattgctgcagactctc
actgcaaaaatcatcggtgacccctccctccacggcagtgtgtggtcctggttagagttc
atcctgacctccgtcttcagcgctctctgggttctccctctgttcgtcctcagcaagata
gtcaacgccatctggttccaggatattgctgaccttgcatttgaagtgtccggctgtaaa
gctcagccattccccagcgtcagtaagatcatcgcagacatgctcttcaacctcctcctc
caggcactcttcctcattcagggtatgatcgttagcctcttcccaatcgatgccattgga
cagatggtgagcctcctgcacatgtctctgctctactccctgtactgctttgagtatcgc
tggttcaaccatggcatcgagatgcaccaacgactgtccaacattgagaggaactggccc
tattactttggctttggtttacctatggctctgctgacagccctgccctcctcatacatc
attagtggctgcttgttctccatccttttccctctgttcatcatcagcgctaatgaagct
aagacgccaactaagctgtaccacttccagctgcgtctcttctccctggtcgtgctgatc
agcaacaagcttttccacaagacggtccacctgcagtcgtccctgacgtcgtccacctcc
tcagagaggctgtcctcccctcacacttctccgagccgccagagactcgtgcccaaccag
tga

KEGG   Paralichthys olivaceus (Japanese flounder): 109636381
Entry
109636381         CDS       T06037                                 

Gene name
tp53i3
Definition
(RefSeq) quinone oxidoreductase PIG3
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109636381 (tp53i3)
Enzymes [BR:pov01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     109636381 (tp53i3)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N HupF_HypC ADH_N_2
Other DBs
NCBI-GeneID: 109636381
NCBI-ProteinID: XP_019953592
LinkDB
Position
Unknown
AA seq 340 aa
MMRAACVDVPGGPESLLLRTVPRPEPKHGEVLIKVHATALNRADLLQRRGLYPPPPGESD
IIGLEVAGTVDTLGPGVKKGWRPEDRVMTLLCGGGYAEYVAVPEELLMPVPQNLTLCQAA
AIPEAWLTAFQLLALVAQVKEGEVVLVHAGGSGVGTAAIQLVRLFGAVSIVTAGSTEKLK
MAEKLGAAAGFNYKEENFAQGVHDFTGGRGAEVILDCIGGCNWEQNVSCLATDGRWVLYG
TMGGRAVEGDFLGKLLSKRGHLLSSLLRSRSLQYKADLVEAFSRRVLSHFSNQAASLRPV
IDSTFNLEDIAEAHRHMEANKNMGKIIINVIPQKQETQMQ
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgatgcgggcggcgtgtgtggacgtccccgggggaccagagagtttgctgctgcggact
gttcccagacctgaacctaaacatggagaggtcctgattaaagttcacgctactgctctg
aacagggcagatttattacagaggcgaggactgtacccacctcccccaggtgagagcgac
atcatcggcctggaggtggctgggactgtagacacgctgggccccggggtgaaaaaaggt
tggaggccagaggacagggtcatgaccctgctctgtggaggaggatacgcagaatatgtt
gctgtgcctgaggagcttctcatgcccgttccccagaatctcaccctgtgccaggctgct
gccatcccagaggcctggctcaccgctttccagctgctggcgctcgtagctcaggtgaag
gagggggaggtggtgctggttcatgctggaggcagcggcgtgggaacggctgccattcag
ctggttcgtctgttcggcgctgtgtctatcgttacggccgggagcacagagaagctaaag
atggctgagaaactgggagccgcagccgggttcaactataaagaggaaaacttcgcacag
ggagttcacgactttacaggaggcaggggagcagaggtcatactcgactgcattggggga
tgtaactgggagcaaaacgtgagctgcttggccaccgatggacggtgggtgctgtacggc
accatgggaggcagagcagtggagggagattttctggggaaactgctctccaagcgagga
cacttgctcagcagcctcctccgctcccgcagccttcagtacaaagcggacctggtcgaa
gctttttctcgtcgagtgttatcacatttctcaaaccaggctgcttccttgaggccagtg
attgacagcacattcaacctggaggatatcgcagaggctcacaggcacatggaggcaaat
aagaacatgggcaagattatcattaatgtgattccacagaaacaggaaactcagatgcag
tga

DBGET integrated database retrieval system