KEGG   Paralichthys olivaceus (Japanese flounder): 109629024
Entry
109629024         CDS       T06037                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04012  ErbB signaling pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109629024
   04068 FoxO signaling pathway
    109629024
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109629024
   04115 p53 signaling pathway
    109629024
   04218 Cellular senescence
    109629024
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109629024
NCBI-ProteinID: XP_019942060
LinkDB
Position
Unknown
AA seq 158 aa
MCRIMAAHKCILSSTVKGSARRNLFGALDREQLQVDYQAALRKDLEEASRRWGFDFMSNK
PLESSDFQWKAIPGTKVPMLYRSCHQRQKKRPREQGQPLQNDKENVPSLPNRCALNLKNF
EKSPEKIEKAGAKRKQTNLTDFYQTKRRVVWMPHKSGE
NT seq 477 nt   +upstreamnt  +downstreamnt
atgtgtagaatcatggcagctcacaagtgcatcctgagctccacagttaagggctccgct
cgacgaaacctgttcggagccttggaccgagagcagctgcaggtggattaccaggcagcg
ttgaggaaagacctggaggaggcctcacgccgctggggtttcgacttcatgtccaacaag
cccctggagagcagcgatttccagtggaaggccatcccaggtactaaggtgcccatgctc
tacaggtcctgtcaccaaaggcaaaagaagcgaccaagagagcaaggtcagccactgcag
aatgacaaggagaacgtcccgagtttgccaaacaggtgtgcactcaatctgaagaacttt
gagaaatcaccagagaaaatagagaaagcaggggccaagaggaaacagaccaacctcaca
gatttctaccagactaaacgaagagtggtttggatgccgcacaaatctggcgagtga

DBGET integrated database retrieval system