KEGG   Paralichthys olivaceus (Japanese flounder): 109629344
Entry
109629344         CDS       T06037                                 

Gene name
cdk2
Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04114  Oocyte meiosis
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109629344 (cdk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109629344 (cdk2)
   04114 Oocyte meiosis
    109629344 (cdk2)
   04115 p53 signaling pathway
    109629344 (cdk2)
   04218 Cellular senescence
    109629344 (cdk2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109629344 (cdk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109629344 (cdk2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pov03032]
    109629344 (cdk2)
   03036 Chromosome and associated proteins [BR:pov03036]
    109629344 (cdk2)
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109629344 (cdk2)
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109629344 (cdk2)
DNA replication proteins [BR:pov03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109629344 (cdk2)
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109629344 (cdk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH
Other DBs
NCBI-GeneID: 109629344
NCBI-ProteinID: XP_019942600
LinkDB
Position
Unknown
AA seq 298 aa
METFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREISLLKELSH
PNIVKLRDVIHTENKLYLVFEFLNQDLKKFMDSSSVNGIPLPLVKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINALGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDETVWPGVTSMPDYKPSF
PKWAKQDLSKVVPLLDEDGRELLGEMLNYDPNKRLSAKNALVHRFFRDVTMPVPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagacgtttcagaaggtggagaagatcggagaggggacgtatggagtggtttacaaa
gccaagaacaaagtcaccggggaaactgtggctctgaagaaaatcaggctcgacacggaa
acagagggtgtaccaagcactgccatccgagagatttcacttctcaaagagctcagtcac
ccaaatattgtcaaactgcgagacgtcatccacacagagaacaaactctaccttgtcttt
gagttccttaatcaggatttaaagaagttcatggactcttcctctgtcaatggcatccca
cttcccctggtgaagagttatctcttccagctgctgcaaggcctggccttctgccactct
cacagggtcctgcatcgagacctgaagccacagaacctcctcatcaatgctctgggggag
atcaagctcgctgactttggccttgcaagagccttcggagtacctgttcgtacatacaca
catgaggtggtaacgctttggtacagagcaccagaaattctcctgggatgcaaatactac
tctacagctgttgacatctggagtctaggctgcatctttgctgaaatgatcaccaggagg
gccttgttccccggcgactctgagattgatcagttattcagaatcttccgcaccttgggc
acacctgatgagacggtctggcctggagtcacatcgatgcccgactacaaaccatctttc
ccaaagtgggccaaacaggatttatccaaagtggttcctcttcttgatgaggacggaaga
gaactgctgggagagatgctaaattacgatccaaacaaaaggttatctgcaaaaaacgcc
cttgtacatcgattcttccgtgacgtcaccatgccagttcctcatctgagactctga

DBGET integrated database retrieval system