KEGG   Paralichthys olivaceus (Japanese flounder): 109629352
Entry
109629352         CDS       T06037                                 

Gene name
cdk4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109629352 (cdk4)
   04115 p53 signaling pathway
    109629352 (cdk4)
   04218 Cellular senescence
    109629352 (cdk4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109629352 (cdk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109629352 (cdk4)
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109629352 (cdk4)
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109629352 (cdk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 109629352
NCBI-ProteinID: XP_019942620
LinkDB
Position
Unknown
AA seq 306 aa
MANATSFQYEPVAEIGGGAYGTVYKARDTESGQFVALKSVRVQTDQNGLPISTVREVALL
RRLEQFDHPNVVRLMDVCATKRSDQETKVTLVFEHVDQDLKTYLERAPAPGLSPDRIKDL
MRQLLCGLAFLHSNRVMHRDLKPENILVTSGGQVKLADFGLARIYSCHMALTPVVVTLWY
RPPEVLLQSSYATPVDIWSTGCIFAEMFRRKPLFCGESEVDQLGKIFEVIGLPPEDEWPT
DVTLSRKHFPSLVPRPIAEFVSEINEQGTQLLLSMLTFDPLKRISALKALEHPYFHEVET
LTQTKR
NT seq 921 nt   +upstreamnt  +downstreamnt
atggccaacgccaccagtttccagtatgagccagtggcagagatcggaggaggcgcttac
gggactgtttataaggccagagacacggagagcgggcagttcgtcgctctgaagagcgtc
cgcgtccagacagaccagaatggcctgcccatctccacagtcagagaggtggctctgttg
agacggctggagcagtttgaccacccaaatgtagtcaggcttatggacgtatgtgccacc
aagaggtcggaccaggaaactaaagtcactctggtatttgagcatgtggaccaagacctc
aagacatacctcgagagagctccagctccgggattatctcccgaccgcattaaagacttg
atgaggcagttgctgtgtggtcttgcattccttcactctaaccgcgtcatgcacagagac
ctgaagcccgagaatatcttggtgaccagcgggggccaggtgaagctggccgacttcgga
ctggcccggatctacagctgccacatggctctcactcctgtggtggtgacactgtggtat
cggccccctgaggttctgctacagtccagttatgccacacctgtagatatctggagcacc
ggctgcatcttcgctgagatgttccgacgcaaaccgttgttctgtggagagtcagaagtg
gaccaacttggaaaaatttttgaagtgatcggcttgccaccagaggacgagtggccgact
gacgtgacgctctcgagaaaacacttcccctcgctcgtgccgcgcccgattgctgaattt
gtttcagagataaatgagcaggggacacaactattgctgagcatgctgacctttgacccc
ttgaaacgaatatctgccctgaaagctctagaacatccatatttccacgaagtggagaca
ctgactcagacaaagagatga

KEGG   Paralichthys olivaceus (Japanese flounder): 109631907
Entry
109631907         CDS       T06037                                 

Gene name
cdk6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109631907 (cdk6)
   04115 p53 signaling pathway
    109631907 (cdk6)
   04218 Cellular senescence
    109631907 (cdk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109631907 (cdk6)
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109631907 (cdk6)
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109631907 (cdk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo RIO1 FTA2
Other DBs
NCBI-GeneID: 109631907
NCBI-ProteinID: XP_019946515
LinkDB
Position
Unknown
AA seq 325 aa
MDRESIGTQYEPVAEIGEGAYGKVYKARDLKNGGRFVALKRVRVQTEEEGMPLSTIREVA
VLRQLEAFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLEKAPDPGVPPETIK
DMMYQLLQGLDFLHSHRVVHRDLKPQNILVTSGGQIKLADFGLARIYSFQMALTSVVVTL
WYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLLRGNSDVDQLGKIFDVVGVPSVEDW
PQEVALPQSAFPPRPPKPIEDLIPDMDEQGRALLMQFLAFNPSRRISAFAALSHPYFQSV
DSHSRSVYAAQPIPSNKPTMEERSA
NT seq 978 nt   +upstreamnt  +downstreamnt
atggacagagagagtattggcactcagtatgagcccgtcgccgagatcggagaaggcgct
tatgggaaagtgtacaaggcgagggacctgaagaacgggggccgatttgtagccctgaaa
agagttcgagtccagacggaggaagaagggatgcctctttccaccatccgggaggtggcg
gtactgaggcagcttgaggccttcgagcaccccaatgttgtaaggttgtttgacgtgtgc
acagtctctcgaactgaccgagaaaccaaactcaccctggtctttgagcacgtggatcag
gacctgaccacctacctggagaaggcccctgaccctggagtaccacctgagaccatcaag
gatatgatgtaccagctgctccaggggttggacttcctgcactctcaccgtgtggtccac
cgcgacctgaagccccagaacatcctggtcaccagcggaggacagatcaaactagcagat
ttcggcctggcgcgcatctacagcttccagatggcgctcacctctgtggtggtgacactg
tggtacagagccccagaagtgctgctccagtccagttacgctacaccagtggacctgtgg
agcgttggctgcatctttgctgagatgttcaggagaaggccgctgcttcgaggaaactca
gatgttgatcagctgggaaagatttttgatgttgtcggggtaccttcagtagaggactgg
ccccaggaagtggcccttccacagagtgccttcccccctcggccccctaagcccatagaa
gacttgattccagacatggacgagcaaggacgggccctcttaatgcaattcctcgccttc
aacccctccaggaggatatcggccttcgcggcactgagccacccctactttcaaagcgtg
gacagccacagtagaagtgtgtacgcggcccagcccatccccagcaacaagcccactatg
gaggagaggagcgcctga

KEGG   Paralichthys olivaceus (Japanese flounder): 109634060
Entry
109634060         CDS       T06037                                 

Definition
(RefSeq) cyclin-dependent kinase 4-like
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109634060
   04115 p53 signaling pathway
    109634060
   04218 Cellular senescence
    109634060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109634060
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109634060
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109634060
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase Kdo
Other DBs
NCBI-GeneID: 109634060
NCBI-ProteinID: XP_019949882
LinkDB
Position
Unknown
AA seq 302 aa
MAFTKPLSYQLLAAVGKGSFGTVYKARELGDKQRFLAVKKFTIHGDSSDSGIPASIIREV
GLLRRMQFFNHPNIVKLLDASVALVDRTLDLTLVLEYIDQDLCTYLSKVPPSVLSLERIK
DVMSQLLQGLDFLHSNMVLHRDLKPANILVSSHGEVKIADFGLARIYTYNIALTPGVVTL
WYRAPEVLLNSVYTSSVDMWSAGCIFAELFLLKPIFLGYTEAQQLWKIFEVIGLPDEEDW
PRNSPIPYSNTWGPNVSCTAILNNVGKDENELLAKCLTFKPSSRISAAEALAHPFFTKDS
VE
NT seq 909 nt   +upstreamnt  +downstreamnt
atggccttcaccaaacctttgagctaccagctgctggcggcggtgggtaaaggctccttc
ggcaccgtgtacaaagccagagaactgggggacaagcagcgctttttggcggtgaagaag
ttcacgatccacggggacagttcagacagcgggatcccggcctccatcatccgggaggtg
gggctgctgcggaggatgcagttcttcaaccatcccaacatagtcaagctgttggatgca
tctgttgcactagtggacaggaccctggacctgactctggtgttagaatacatcgaccag
gacctgtgcacctacctctccaaggttccgccctctgtactgagccttgagcgtatcaag
gatgtgatgtcgcagctgctgcaaggattggatttcctacactcaaacatggtgctgcat
cgtgacctaaagccagcaaacatcctggtcagcagccacggagaagttaagattgcagac
tttggactggcacgcatctacacctataatattgctctcactccaggtgtggtgacgctg
tggtacagagctcctgaggtgctgctgaactcagtctacacgtcctcagtggacatgtgg
agcgctggctgcatcttcgccgagctcttcctcttgaaacccatttttctcggatacact
gaggcgcagcagctgtggaaaatctttgaagttatcggtttgccagatgaggaggactgg
cccaggaacagtcccatcccatactcaaatacctggggaccaaatgtttcctgcaccgcg
atactgaacaacgtgggcaaagacgagaacgaacttctcgctaaatgtttgacgttcaaa
ccaagcagccgcatctccgctgccgaagctctggctcatcccttcttcacaaaggactcg
gtcgagtga

DBGET integrated database retrieval system