KEGG   Paralichthys olivaceus (Japanese flounder): 109630724
Entry
109630724         CDS       T06037                                 

Gene name
casp9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04370  VEGF signaling pathway
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109630724 (casp9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109630724 (casp9)
   04115 p53 signaling pathway
    109630724 (casp9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109630724 (casp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pov01009]
    109630724 (casp9)
   01002 Peptidases and inhibitors [BR:pov01002]
    109630724 (casp9)
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     109630724 (casp9)
Protein phosphatases and associated proteins [BR:pov01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109630724 (casp9)
Peptidases and inhibitors [BR:pov01002]
 Cysteine peptidases
  Family C14: caspase family
   109630724 (casp9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2 MM_CoA_mutase
Other DBs
NCBI-GeneID: 109630724
NCBI-ProteinID: XP_019944605
LinkDB
Position
Unknown
AA seq 435 aa
MEEKHKKILQRNRVSLVSVLDPSTLYDGLLQRGVFTQDMIDEIKSSGTRRDQARQLVRDL
ETRGSQAFPLFLQCLQETGQQSLSELLQNGVPPVHVQPATPTEVVRPVIQPLPITPPMDV
DKQRKDDVPVNPLPRPSTTPSPSPERESIRPRPLGRTRRDSIQSYKMDASPCGHCLIINN
VEFSPQSGQTNRRGSNVDCGKLERRFKKLNFIVEVKTNMKQRQIKHELSTLSKKDHSSFD
CCVVIMLSHGTEVSHNRFPGAVYGVDGEYVPVQHITNYLNGKHCPSLQGKPKLFFIQACG
GGEKDMGYEVSPDEFKPHVGGADDQTDAIPMSSSSDSLSMSDEPDARVTLPTPCDILVSY
STFPGYVSWRDPEAGSWYVETMDRVLEENAATDDLVTMLMMVNHEVSQNSAKGLYKQMPG
SFNFLRKLLYFQTQT
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggaagaaaaacacaagaagatccttcagcgcaacagggtcagtctggtgagtgtgctg
gacccatccacgctctacgatggccttcttcaaagaggagttttcacgcaagacatgatc
gatgagattaagagctctgggaccagacgtgaccaggccaggcagttagtccgggactta
gagacccgcgggagtcaagcctttccattattcctgcagtgtcttcaggagacgggtcag
cagagtctgtcagagctcctgcagaatggagtcccaccagttcatgtacaacctgctaca
cccactgaggttgtccgccctgtgatccaacctctcccaatcacccccccaatggatgtt
gataagcagagaaaagacgatgtccctgtcaatcctttacctcgaccaagtaccactccc
agtccgtcacctgaaagggagagtataagaccaaggccactgggcagaacacgacgggac
agtattcagagctacaaaatggacgccagcccatgtggacactgcctcatcataaacaac
gtggagttcagccctcagagcgggcagaccaatcgtagaggctccaacgtcgactgcggc
aagctggagagaagattcaagaagctcaacttcattgtggaagtcaagaccaacatgaaa
caaagacaaatcaagcatgagctgtcaactttgtccaaaaaggaccactcaagctttgac
tgctgtgtggttatcatgctgtcccatgggactgaggtgagtcacaaccgcttccctggt
gctgtgtatggtgtggacggagagtatgtcccagttcaacatatcacaaactacctcaac
ggcaagcattgcccttctttacaaggcaaacccaaactgttcttcatccaggcgtgtgga
ggaggtgaaaaagacatgggctatgaggtgtcccctgacgaatttaagccacacgttggt
ggagcagatgaccagacagacgccattccaatgtcgtccagcagcgactccctgagcatg
tctgatgaaccagatgccagagtcactctgcccacaccatgtgacatcctggtgtcctac
tcaacgtttcctggttacgtttcttggagagaccccgaggcaggatcgtggtatgttgag
acaatggaccgtgttctagaggaaaatgctgctactgatgacctggttacaatgttgatg
atggtgaaccacgaagtctctcaaaactctgcaaaagggctctacaagcaaatgcctggt
tcctttaacttcctccgaaaacttctctactttcaaacccaaacatag

DBGET integrated database retrieval system