KEGG   Paralichthys olivaceus (Japanese flounder): 109630748
Entry
109630748         CDS       T06037                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04210  Apoptosis
pov04620  Toll-like receptor signaling pathway
pov04621  NOD-like receptor signaling pathway
pov04622  RIG-I-like receptor signaling pathway
pov04623  Cytosolic DNA-sensing pathway
pov04625  C-type lectin receptor signaling pathway
pov04920  Adipocytokine signaling pathway
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109630748 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109630748 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109630748 (ikbkg)
   04621 NOD-like receptor signaling pathway
    109630748 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    109630748 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    109630748 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    109630748 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109630748 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109630748 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109630748 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109630748 (ikbkg)
Protein kinases [BR:pov01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109630748 (ikbkg)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10
Other DBs
NCBI-GeneID: 109630748
NCBI-ProteinID: XP_019944648
LinkDB
Position
Unknown
AA seq 687 aa
MSESSVSQVEALCLVVTGGDVMFPCRPPVLALTAQGESAHQHTSAAPSRPQGLLSEQGAQ
IQRKGQTERERMVQPQPDGPMQWDMSGEDSGGALRVPPELAANEVVTRLLGDNQQLREAL
RRSNLALRQRCEEMEGWQRRTREEREFLSSRFQEARALVERLAQENHSLQGLVNGPASSS
SHCSSQTEDLQGRPAKNGPHEGPQVSMTLDQRETKKVKEMDQHTQTTPPRSLDVSLSSYL
PTPPSSFSEVQGEVMGRDNGQPVEGSNEILQLLKSHKEKLEEGMRELRKKNEELEWDREE
GEKERERMRRCIEQLRTKLAQAQANSVAEEVVQHRSEAQHSSDCSSLAKLTEQLQATQGR
YRELEEKLDYLQKSSAQRDRTEALLKQKDKDCAQLAKDCEALKAQATSLLGELNERQSCL
EKSEHERKMLDEKLCSKLKALQVAERELEQQKKQHHVAMDKLLLQTQSLEQALKTERHVV
TEEKKKLTQLQHAYTCLFRDYDSKLKSEGGDLCSRLEEAERALALKQDLIDKLKEEVEQQ
KGSLETVPVLTAQAEIYKADFLAEREAREKLNQKKEELQDQLTQAMAEIDRLKQEATSRA
RMELMKKRHVEDFPPRAPHIPPPKGVFPGPAFNTVPAASSFRNQGLVPVSDQGAAGSEEL
PDLCCPKCKYQAPDMDTLQIHVMDCIQ
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgtcagaatcgagcgtgtctcaagtcgaagctctttgcctcgtggttaccgggggtgac
gtcatgtttccctgcagaccaccggtgcttgctttgacagctcagggggagtccgcacac
cagcacacatcagcggcccccagcaggccacagggcctcctctccgagcagggggcccag
attcagaggaaagggcaaacagaaagagaaaggatggtgcagccccagccagatggcccg
atgcagtgggacatgtcaggcgaggacagtggaggcgccctcagggtcccacctgagctg
gctgccaacgaagttgtgaccaggttgctgggcgataaccagcagcttagagaggccctg
cgacgaagcaacctagccttgcgccagcgctgcgaggagatggaggggtggcaacgaagg
acgagagaggaaagagaatttctcagctctcgcttccaggaggccagggccctggtggag
aggctggcccaggaaaaccactccttacagggcctggtaaatggaccagcctcgtcctca
tctcactgctccagccagacagaagacctgcagggacgcccggcaaaaaacggtccacac
gagggaccgcaggttagcatgactctagatcagcgtgagacaaagaaagtcaaagagatg
gatcaacacacacagaccacaccacctcgcagcctggatgtctccttgagtagctacctc
cctactcccccgtcctcattttcagaggtacagggggaggttatgggcagggataatggc
cagcccgtggaaggttcaaacgagatcctgcagctcctgaagagccacaaagaaaagctg
gaggaaggcatgagagagctgaggaagaagaacgaagagctcgagtgggacagagaagag
ggagagaaagagagggaacggatgcggcgttgcattgagcagctacgcaccaaacttgcc
caggcacaggcaaacagtgttgctgaagaggttgttcaacatcgctctgaggcacagcac
tcctctgactgctctagtctggctaaactcacagagcagcttcaggccacacagggcagg
tatcgggagctcgaggagaagcttgactacctgcagaagagttcagctcagcgggacaga
actgaagctctgctgaaacagaaggacaaggactgtgctcagctagccaaggactgtgag
gctttgaaagcccaggcaacttccctattaggagaactgaacgagagacagagctgtcta
gagaaaagcgagcatgaacgcaaaatgttggacgaaaagctgtgcagtaaactgaaggcc
ctacaggtggcagagcgggagctggagcagcagaagaagcagcatcatgtggctatggac
aagcttctgctgcagacccagagcctggagcaggccctgaagaccgagagacatgtggtc
acagaggagaagaaaaaactgacacaactgcagcatgcctacacgtgcctcttcagagac
tatgattctaaactcaagagtgagggaggagatctgtgcagccgactagaggaggcagag
cgagcgctggccctgaagcaggatctcatcgataaactgaaggaagaggtggagcaacag
aaaggctcactggagacggttcctgtcctcactgctcaggctgagatctacaaggcagat
ttcctagcagagcgagaagcaagagagaagctgaaccaaaagaaagaggagctgcaggac
caacttactcaggccatggctgagattgacaggctcaaacaggaagccacatcacgcgca
cgtatggagctaatgaagaagcggcatgtggaagactttccaccacgggcgccacacatt
cctcctccaaaaggggtgttccctggtccagcttttaacacggtacctgctgcctcatca
ttccgtaatcagggtttggtgccagtcagtgatcaaggggcagctggatctgaggagctg
ccggatttatgttgtcccaagtgcaagtaccaggctccagatatggacacgctgcagata
cacgtcatggactgcatacagtaa

DBGET integrated database retrieval system