KEGG   Paralichthys olivaceus (Japanese flounder): 109630878
Entry
109630878         CDS       T06037                                 

Gene name
tp73
Definition
(RefSeq) tumor protein p73 isoform X1
  KO
K10148  tumor protein p73
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109630878 (tp73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pov03000]
    109630878 (tp73)
Transcription factors [BR:pov03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    109630878 (tp73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 109630878
NCBI-ProteinID: XP_019944920
LinkDB
Position
Unknown
AA seq 690 aa
MQTKVKRVICPSPDYPSFKMSQSTVTEEGGTFEHLWSSLEPDSTYFELPPGSQPGERPVP
STSTPGSHCSAAEVSMDIYHMRDMNDNVMSQYNLLSSSMDSLGSRATSASPYSSENASSS
TVPTPSPYSQPNSTFEGLSPAPAIPSNTDYPGPHTFQVSFQQSSTAKSATWTYSPLLKKL
YCQIAKTCPIQIKLSSSPPHGSILRAMPIYKKAEHVTEVVKRCPNHELGRDFNDGQAAPA
SHLIRVEGSNLCQYVDDPVTGRQSVFVPYEAPQVGTEFTTILYNFMCNSSCVGGMNRRPI
LIIITLETRDGQVLGRRSFEGRICACPGRDRKADEDHFREQQALNENIAKNGSASKRNFK
QSPPNIPSPNINMRKRRHGEEEIYYIPVRGRENFELLMKIKDSLELVELVPQPLVDSYRQ
QTQQQLLQRPSHISSPTAYSPLSNMNKLHAHGGLSKPPSVNQLVGQQPQQHPSAPTSIAH
MGSNMLNSHHMQANGDMNGGHSSQPLMSASHCSPPPPYNPDPSLVSFLTSLGCQNFIEYF
TSQGLQSIYHLQTLSMEDLGALKIPEQSRLAIWRGLQDMKQGAPIQLPASNHHHDYHGQQ
LLRSSGNMAASAMAAIGAAGGELQRQRVMEAVHFRVRHTITIPNRSGVVGTSGMAATGDE
WADFGFDMPDCRMSRNKHSIKEEFMESDVH
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgcagaccaaagtgaaacgagtgatctgtccctcaccagactacccatcctttaagatg
tcccagtccactgtcactgaagagggaggcacctttgagcacctgtggagttccctggag
ccagacagcacctactttgagctcccaccaggcagccagccaggtgagcggccagtgccc
tccaccagcaccccggggagccactgcagcgctgccgaagtctccatggacatctaccat
atgagggacatgaacgacaatgtgatgtcccagtacaacttgctgagcagcagcatggac
agcctggggagccgtgcgacctccgccagcccctacagctccgagaacgcctcctcgtcg
accgtgcccaccccctctccctactcccagcccaactccaccttcgagggcctgtcgcct
gcccctgccatcccctccaacaccgactaccctggaccacacaccttccaggtgtccttc
cagcagtccagcaccgccaagtctgccacatggacttactcgcccctgctgaagaaactc
tactgtcagattgccaagacctgtccgatccagatcaaactgtcctcctctcctccacat
ggcagcatcctcagagcaatgcccatttacaagaaggcagagcatgtcacagaggtggtc
aagcgctgccctaatcatgaactggggcgagatttcaatgacggtcaagcagccccagcc
agtcacttgatccgggtggaggggagtaacctctgtcagtatgtggatgatcctgtcact
ggccgacagagcgtcttcgtgccctatgaggctcctcaggtggggactgagtttaccacc
atcctgtataacttcatgtgcaacagcagctgtgtgggtggcatgaacaggagacccatc
ctcatcatcatcaccttggagaccagggatggtcaagtcttgggcaggaggtcgttcgaa
ggtcggatatgtgcgtgtcctggcagagaccgcaaagctgatgaggatcacttcagggaa
caacaggccctgaatgagaatatagccaaaaatggcagtgccagtaagcgcaactttaaa
cagagtccgccaaatatcccgagtccaaatattaacatgaggaagagacgacacggagaa
gaagagatttactacattcctgttcgtggcagagagaactttgagctgctgatgaagatt
aaagacagtctggagctggtggagttggtgccacagcctctggtggactcttatagacaa
caaacacagcagcaactgctgcagagaccgagtcatatatcctcccccaccgcttactct
ccactgtccaacatgaacaagcttcatgcccatggaggcctgagcaaaccgccctcagtc
aaccagctggtggggcagcagccccagcaacacccctctgcccccacctccatagctcat
atgggttcaaacatgctcaacagccaccacatgcaggccaacggtgatatgaacggtggc
cacagcagtcagcctctaatgtctgcttcccactgcagcccaccccctccgtataaccct
gaccccagcctcgtcagttttctgaccagtctgggctgtcaaaacttcatcgagtacttc
acctcccaaggcctccagtctatctaccatcttcagactctctccatggaggacttaggt
gcgctgaagataccagagcagtcccgcctcgccatctggagaggtctgcaggacatgaaa
cagggtgctcccatccagctgcccgcctctaatcatcaccatgactaccatggccagcag
cttcttcgctccagtggcaacatggctgcctctgcgatggctgccatcggtgctgctggt
ggcgaactgcaacgccagcgcgtcatggaggccgtgcactttcgcgtccgccacaccatc
actatccctaacaggtcaggtgtcgttgggacctcaggtatggctgcgactggtgatgag
tgggctgactttggtttcgacatgcccgactgcagaatgtcacgcaacaaacactccatc
aaggaggagttcatggaaagtgatgttcactga

DBGET integrated database retrieval system