KEGG   Paralichthys olivaceus (Japanese flounder): 109631024
Entry
109631024         CDS       T06037                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04217  Necroptosis
pov04620  Toll-like receptor signaling pathway
pov04621  NOD-like receptor signaling pathway
pov04622  RIG-I-like receptor signaling pathway
pov04625  C-type lectin receptor signaling pathway
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109631024
   04217 Necroptosis
    109631024
   04115 p53 signaling pathway
    109631024
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109631024
   04621 NOD-like receptor signaling pathway
    109631024
   04622 RIG-I-like receptor signaling pathway
    109631024
   04625 C-type lectin receptor signaling pathway
    109631024
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109631024
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109631024
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109631024
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     109631024
Peptidases and inhibitors [BR:pov01002]
 Cysteine peptidases
  Family C14: caspase family
   109631024
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN Sbi-IV RGCC
Other DBs
NCBI-GeneID: 109631024
NCBI-ProteinID: XP_019945143
LinkDB
Position
Unknown
AA seq 494 aa
MDFQKLLLDVGKALGTDEVKALIFLCTDILDRNPTSVKSANDLFSRLAERDHLSHERRDL
LTELLRTIQRLDLVSAFNLNDREPTTTSLISPYRKLLYNLYEEMTREDLEEVKFLLYKTV
PRRKLEDNYSLLDVFLKMEHMDILSDTNLSELETIIYSVCPKMRGQINQFKTQQEALQSS
TQYSVDSSSTVLNSSESHLSSEMSSLSFSEHCLNSDTVSASQESRSLPENQTSTNSEDLG
IYPMTEAKRGICLIINNHVFHETSLKPRDGTMIDEECLRDVFKWLGFDVEVHLNCTREKM
LSLLWDLGRRDHRQMSCVACFVLSHGLEGGVHGVDNKIVKINDLMEPLNARNCPTLAQKP
KLFFIQACQGKKEQSAVYIEADGPATSLICTDAVRDSFPVDADFLISMATVPSFVSYRDK
QRGTWFIQSLCKYLIQMVPSGFDLLSILTKVNDDVSQKTDSTGEKKQMPQPAFSFRKRVV
FPVPEAPSPRLPSV
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggatttccagaagctcctgttagatgtggggaaggccctgggtacggacgaggtaaaa
gctctaatatttctttgcaccgacatcctggaccgaaatccaacctctgtgaagtcagcc
aatgacctcttctctcgtctggcggaacgagaccatctctcgcatgagcgacgagacctg
ctgactgagcttctgcgcaccatacaacgcctcgacctagtcagtgccttcaatctcaac
gacagagaacctacaaccactagcctcatctctccctacaggaagctgctctacaacctg
tacgaggagatgactcgagaggacttggaagaagtgaagtttttgttgtacaaaacggtc
ccacgtagaaaactggaggacaattattcgttgctggacgtcttcctgaagatggagcac
atggacatcctgagtgacactaacctaagtgaactggagacgatcatttactcagtctgt
cccaagatgagaggacagatcaaccagttcaagacacagcaggaagccctccagtcatct
acccagtattccgttgattcttccagcactgttctgaattcttcagaatcacacttaagc
agtgaaatgagcagcctttccttctcagaacattgtttgaacagtgatactgtttcggcg
tctcaagaaagcaggagcctccctgaaaatcagacatctacaaacagtgaggatttgggc
atctatcccatgactgaagcaaagagaggtatctgcttgattatcaacaaccacgtcttc
catgagaccagtctcaagcctcgtgatggcaccatgattgatgaagagtgtctgagggat
gtgtttaagtggctgggctttgacgtcgaggtacatctcaactgtacacgtgagaagatg
ctgtctttgttgtgggatcttggcaggagagaccacaggcagatgtcctgcgtggcgtgc
tttgttctcagccacggcctggagggaggagtgcacggtgtcgacaacaaaattgttaag
atcaacgacctgatggagcctttgaatgcacgtaactgcccgactttggcccaaaaaccc
aaacttttcttcatccaggcttgccagggcaaaaaagagcagagtgcagtgtacatcgag
gccgatggccccgcaaccagtctcatctgtactgatgctgttagagactcctttccagta
gatgcggatttcctgatatcgatggccaccgttccttcctttgtttcctacagagataag
cagaggggcacctggtttattcagtcattgtgcaagtacctcatccagatggtgccaagt
ggctttgacctcttgtccatcctgaccaaagtgaatgacgatgtgagccagaagaccgat
tccactggtgaaaaaaagcaaatgcctcagccagccttctcgttcaggaagagggtagtc
ttcccggtgcccgaggctccttcccccaggctgccctctgtttga

KEGG   Paralichthys olivaceus (Japanese flounder): 109637364
Entry
109637364         CDS       T06037                                 

Definition
(RefSeq) caspase-8-like isoform X1
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04217  Necroptosis
pov04620  Toll-like receptor signaling pathway
pov04621  NOD-like receptor signaling pathway
pov04622  RIG-I-like receptor signaling pathway
pov04625  C-type lectin receptor signaling pathway
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109637364
   04217 Necroptosis
    109637364
   04115 p53 signaling pathway
    109637364
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109637364
   04621 NOD-like receptor signaling pathway
    109637364
   04622 RIG-I-like receptor signaling pathway
    109637364
   04625 C-type lectin receptor signaling pathway
    109637364
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109637364
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109637364
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109637364
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     109637364
Peptidases and inhibitors [BR:pov01002]
 Cysteine peptidases
  Family C14: caspase family
   109637364
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 109637364
NCBI-ProteinID: XP_019955212
LinkDB
Position
Unknown
AA seq 484 aa
MDRLKLSRIDEELDSSEVAALCFLCLDVVNKKRLEGIKDAKGLFLRLEEKGLLENSLFLS
QLLQTIRRTDLLSYLETDSRQPEETDASPTLSSYRVMLYNIYDDMTRENLEKLKFLLSNK
LNKRQIEASDTALDLFIKMEKTGLLSDTNLLELHGALQEFDQQLALTVQNQITPQDQTRV
LPQVSMDYQSVNNRSQPSLSISETWPSYDQDRINCDAEPNEEPSSLSDESEYYTLKHNPR
GLCVVINNEKFPGLQLKNRPGTQEDAKALRSVFTRLGFTLVLLNDMTADAMRQELNNLGR
NNFIDHDALVVCVLSHGEKGCVFGIDEQEVSLRELTEPFTSKRACTLAGKPKLFFIQACQ
GSGYQRGSLPCPPTPRQEEEVKQSRLEEDAGRIHGETVPWDADFLLGMATVPECRSFRNT
STGSIYIQELCRQLVRSAESLEDDDILAVLTRVNRNVSRKEYLNFKQMPEPKYTLTRKLV
LKFV
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggatagactgaagctgtcccgcatagatgaggagctggactcctctgaggtggcagca
ctttgcttcttgtgtcttgatgttgtcaacaagaaacgcttggaggggatcaaggatgca
aaagggctgttcttgagactagaagaaaagggtctgctggaaaacagtttgttcctttct
cagctgctccaaactatccgtcgaacagatctcctcagctacctggagacagacagcagg
caaccagaggaaacagatgccagtcccaccctgtcgagttacagggtgatgctgtacaac
atatacgacgacatgactcgggagaatcttgagaagttgaagtttctgttgagcaacaag
ttaaacaagagacaaatagaggccagcgatactgcattggatttattcattaaaatggaa
aagaccggtttactgtcagacacaaatctcctggagctgcatggagctctgcaggagttc
gatcaacaactggccttgactgtgcagaaccagataaccccacaggatcagacaagagta
ctgcctcaggtcagtatggattaccagagtgtcaacaaccgctctcaaccttcactgtcc
atatcagagacttggcccagttatgatcaagacagaattaactgtgacgcagaaccaaat
gaagagccatcctctctttctgatgagtcggagtactacactctgaaacataaccctcgt
ggtttgtgcgtggtcatcaacaatgagaaattcccgggactacagctgaaaaatagacct
ggaactcaggaggatgcaaaggctctgcgttcagtgttcacccgccttggcttcacattg
gtgttactgaatgacatgactgctgacgccatgcgacaggagttaaacaatctgggcaga
aataactttattgatcatgatgccttggtggtttgtgtgctctcccacggagaaaaggga
tgtgtctttgggatagatgagcaggaggtgtcactgcgagaattgacagagcccttcacg
agcaaaagagcctgcaccctggcagggaagcccaaactgttctttatccaggcatgccag
ggaagtggctaccagagaggatccctgccatgtcccccgacaccgagacaggaggaggag
gtcaaacagagtcgtctggaggaagatgcaggccgcatccatggtgagacggtgccttgg
gatgcagacttcctgctcggcatggccaccgtgcctgagtgcagatcatttcgaaacact
agcacaggctccatctacatccaggagctgtgcaggcagctggtccgatcagcagaaagc
ctggaggatgatgacatactagctgttctgacacgtgtgaacaggaacgtcagccgaaaa
gagtatttgaacttcaaacaaatgccggagcccaagtacactctgaccaggaagcttgtc
ctcaaatttgtatga

KEGG   Paralichthys olivaceus (Japanese flounder): 109641073
Entry
109641073         CDS       T06037                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04217  Necroptosis
pov04620  Toll-like receptor signaling pathway
pov04621  NOD-like receptor signaling pathway
pov04622  RIG-I-like receptor signaling pathway
pov04625  C-type lectin receptor signaling pathway
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109641073
   04217 Necroptosis
    109641073
   04115 p53 signaling pathway
    109641073
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109641073
   04621 NOD-like receptor signaling pathway
    109641073
   04622 RIG-I-like receptor signaling pathway
    109641073
   04625 C-type lectin receptor signaling pathway
    109641073
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109641073
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109641073
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109641073
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     109641073
Peptidases and inhibitors [BR:pov01002]
 Cysteine peptidases
  Family C14: caspase family
   109641073
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 109641073
NCBI-ProteinID: XP_019960946
LinkDB
Position
Unknown
AA seq 384 aa
MSAKNNLRCNKTEIIRVLSADHRLILNKAQETELINQREYNNLKSINKEDVEGHVTELVD
KIMNKGEDSCKYFMDLLQTDDIISTYPELKKILNDTCHLPKPVQESADAMPPESKRVKRE
EQYQLKSQPVGLCVIINNENFNESKMRRGTNKDAQCLAEVFTWLRFRVLMCKDQTKDQME
RALSCFASLSDPSQLQEFNVKEWIDSRFAELQQTPLKHGDAFICCILSHGSNGVVIGTDG
LPLPIKKITQTFKSSDQSALTGKPKVFLIQACQGKQIQLGVLSKDLEADDSTSPFIPEGA
DVLVAIATVEECVSFRHPIDGSWFIQSVCQQLKEGCPRHDDINTILNRVNNEVSQKEGCK
QCGAAKQMPEVRFTLRKTLVLSPP
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtctgccaaaaacaacctgcggtgcaataaaacagaaattataagggttttgtctgca
gaccacaggctgatcctaaacaaagctcaggagacagaactgataaaccaacgtgagtac
aataacctgaaaagcatcaacaaagaagatgtggagggacacgtcactgagcttgtggat
aagatcatgaacaaaggagaggactcctgcaaatatttcatggacctcctgcaaaccgac
gacataataagtacttaccctgagctgaagaagatactgaatgacacctgccatctacct
aagcctgtccaagagtcagcagatgctatgccaccagagagcaagagggtcaagagggag
gagcagtaccagttgaagagtcagcccgttggcctctgtgtcatcattaacaatgaaaac
ttcaatgaaagcaaaatgagaagaggaaccaataaagatgctcaatgtttggcagaggtg
ttcacctggctgcgcttcagagtgctgatgtgtaaagaccaaaccaaggaccagatggag
cgagcgctgagctgctttgcctctctgagcgacccctctcagctgcaggagttcaatgtt
aaggagtggattgacagcagatttgctgaactccagcagacacctctgaagcatggagat
gccttcatctgctgcattctgagccacggatcaaatggggtagtcatcgggacagatggg
ttgcccctccccattaaaaaaattactcaaactttcaagtcgagcgaccagtctgccctc
accggtaaacccaaagtgttcctgatccaggcctgccaaggaaagcagatacagcttgga
gtgttgtcaaaagacctggaggctgacgattcaacctcaccattcattcctgaaggggcc
gatgttctggttgctatcgctactgttgaggaatgtgtatcatttagacacccaatcgac
gggagctggttcatccaatcagtgtgccagcagctaaaggagggctgtcccaggcatgat
gatatcaacaccatcctcaaccgtgtgaataatgaagtaagccagaaagagggctgtaaa
caatgtggagcagcaaagcagatgcctgaagtcaggttcaccctgaggaaaacacttgtg
ctgtcacccccttaa

DBGET integrated database retrieval system