KEGG   Paralichthys olivaceus (Japanese flounder): 109631170
Entry
109631170         CDS       T06037                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6-like isoform X1
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04060  Cytokine-cytokine receptor interaction
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04217  Necroptosis
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109631170
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109631170
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109631170
   04217 Necroptosis
    109631170
   04115 p53 signaling pathway
    109631170
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109631170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pov04050]
    109631170
   04090 CD molecules [BR:pov04090]
    109631170
Cytokine receptors [BR:pov04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109631170
CD molecules [BR:pov04090]
 Proteins
  109631170
SSDB
Motif
Pfam: TNFR_c6 Death Adeno_E3_CR2 PTP_tm DUF4381
Other DBs
NCBI-GeneID: 109631170
NCBI-ProteinID: XP_019945332
LinkDB
Position
Unknown
AA seq 330 aa
MSPALPGSPLQKQRVLCCNRNLRSHVALKDFSSASPQTEKTLPVHLVKGLSRSRRQECAH
GDYRHEGRTCCMCGPGLRLMTHCSVNQNDGQCESCATGTYSSHPNSQESCEPCTSCGQPD
ANLEEEESCTRARNTKCRCKKGHYCSTSTEKCLLCHLCKECGSDGVRVACTATNDTVCHD
KSEGGNAGIIAGIIVPLVLIALIGVAVWCCRRRNRKQYTPGQPNGNAQTVELQTLNELQS
KHMPDIAAALGWKNMRDVAMRSGMTTVEIDSCKQSAPTDPEEMTLQLLSKWIEKEGRGAA
TRLITLLEKNHKRDKAERVAEILRRGDAPV
NT seq 993 nt   +upstreamnt  +downstreamnt
atgagcccagcgctgcccggctcgccacttcaaaaacaacgagtactttgctgcaatcga
aacttgcgcagtcatgtcgcattaaaggacttttcttcagcctcgccccaaactgagaag
acgctcccggtgcatttagttaaaggactgtcccgcagcaggaggcaggagtgtgcacat
ggcgactaccgtcacgaggggaggacctgctgtatgtgtggacctggcctgcggctgatg
actcactgctctgtcaatcaaaatgatggacaatgcgagtcctgtgctactgggacttac
agcagtcatcccaatagccaggagtcctgtgaaccctgcacatcctgtggacaacccgat
gctaatctagaggaggaagaatcctgtacccgagcccgtaacactaaatgccgatgtaaa
aaaggtcattattgcagcaccagcacagagaagtgcttactctgccacctttgcaaagaa
tgtggctcagatggtgtcagggttgcttgcacagccacaaacgacacggtctgccatgac
aaatctgaagggggaaatgctggaattatagctggaataattgtcccactggtgcttatt
gcactaattggagttgcagtctggtgttgcagaaggagaaatagaaaacaatataccccc
ggccagccaaatggcaatgcacagacagtggagctgcagactctgaatgagctccaatct
aagcacatgcccgacattgcagccgctcttgggtggaagaatatgcgggatgtagcaatg
cgtagtgggatgacaacagttgaaattgattcttgtaaacagagcgcccccactgaccct
gaggagatgaccctccaactgctatcgaaatggatagagaaggagggtaggggtgcggca
acaaggttgatcacactcctagaaaagaatcataaaagggacaaagcagagagggtggca
gagatattgagaagaggagatgctcctgtttga

DBGET integrated database retrieval system