KEGG   Paralichthys olivaceus (Japanese flounder): 109631249
Entry
109631249         CDS       T06037                                 

Gene name
rprm
Definition
(RefSeq) protein reprimo
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109631249 (rprm)
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-GeneID: 109631249
NCBI-ProteinID: XP_019945444
LinkDB
Position
Unknown
AA seq 102 aa
MNNTGFNQTQGALLNKTEELFCCNFSSVVTDNGFVAAAPDERSLFIMRVVQIAVMCVLSL
TVVFGIFFLGCNLLIKSEGMINFLVTDRRPSKETEAVIVGAY
NT seq 309 nt   +upstreamnt  +downstreamnt
atgaacaacacggggttcaaccagacgcagggcgcactgctcaacaagacggaggagtta
ttctgctgcaacttttcctccgtggtgactgataatggcttcgtggctgcggcgccggac
gagaggagcctcttcatcatgagggtggtccagatcgccgtcatgtgcgtcctgtccctc
accgtggtctttggcatattcttcctgggctgcaacctcctcataaagtcagaggggatg
atcaacttcttggtcacggacaggagaccctctaaagaaacggaggccgtcattgttgga
gcttattga

KEGG   Paralichthys olivaceus (Japanese flounder): 109634075
Entry
109634075         CDS       T06037                                 

Definition
(RefSeq) reprimo-like protein
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109634075
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-GeneID: 109634075
NCBI-ProteinID: XP_019949905
LinkDB
Position
Unknown
AA seq 111 aa
MNDSFFDQTQGALFNGSQTLAGTLATFYGNGTGNVVTGDGGGSLVLLQEERKLFVMRVVQ
IAVLCVLSLTVMFGIFFLGCNLMIKSESMINFLVKDRRPSKDVETVMIGLS
NT seq 336 nt   +upstreamnt  +downstreamnt
atgaacgactccttcttcgaccagacccagggcgcactgttcaacgggagtcagactctc
gccggaactctggccacattctacggcaacggcaccggcaacgtggtgaccggtgacggt
ggagggtcgctcgttctgctgcaagaggagcgcaaactatttgtcatgcgtgtggtgcag
atcgctgtgctgtgcgtactgtcgctcaccgtcatgttcggtatatttttcctcgggtgc
aacctgatgatcaaatcggagagcatgattaacttcctggtgaaggaccgcagaccctcc
aaggacgtggagacggtcatgatcggcctcagctag

DBGET integrated database retrieval system