KEGG   Paralichthys olivaceus (Japanese flounder): 109631327
Entry
109631327         CDS       T06037                                 

Definition
(RefSeq) cytochrome c-b
  KO
K08738  cytochrome c
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109631327
   04115 p53 signaling pathway
    109631327
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109631327
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109631327
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Other DBs
NCBI-GeneID: 109631327
NCBI-ProteinID: XP_019945563
LinkDB
Position
Unknown
AA seq 105 aa
MPADINKGKKAFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGII
WDEETLMIYLENPKKYIPGTKMIFAGIKKKNERTDLIAYLKSATS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgcctgcagacattaacaaaggcaagaaggcatttgtccagaagtgtgcccagtgccat
actgtggagaatggtggaaagcataaggttggacccaacctttggggtctgttcggacgc
aaaacaggccaggcagagggctactcctacactgatgccaacaaaagcaaaggtatcatc
tgggatgaggagaccctgatgatttatttggaaaaccccaagaaatatataccaggaaca
aagatgatcttcgccggcatcaaaaagaagaacgagcgtaccgatctcatagcatatctc
aagtctgcaacctcataa

KEGG   Paralichthys olivaceus (Japanese flounder): 109631651
Entry
109631651         CDS       T06037                                 

Definition
(RefSeq) cytochrome c-a-like
  KO
K08738  cytochrome c
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109631651
   04115 p53 signaling pathway
    109631651
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109631651
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109631651
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Dehyd-heme_bind
Other DBs
NCBI-GeneID: 109631651
NCBI-ProteinID: XP_019946082
LinkDB
Position
Unknown
AA seq 104 aa
MGDIQKGKKVFVKKCSQCHTVEEGGRHKVGPNLWGLFGRKTGQASGFSYTKANIEKGIIW
DEKTLNVYLENPKKYIPGTKMVFSGIRKKKERQDIIAYLKDATS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggggacatccagaaagggaagaaggtatttgtcaagaaatgttcccagtgtcacaca
gtggaagaggggggacgccacaaggtgggacccaacctgtggggtctgttcgggaggaag
acgggtcaggcgtccggcttctcctacacaaaggccaacattgagaaaggtatcatatgg
gacgagaaaacactgaatgtctacctcgaaaacccaaagaagtacattcctggcaccaag
atggtcttctctgggatcaggaagaaaaaggagagacaggatattatagcttatttaaag
gatgccacctcctag

KEGG   Paralichthys olivaceus (Japanese flounder): 109635887
Entry
109635887         CDS       T06037                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109635887
   04115 p53 signaling pathway
    109635887
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109635887
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109635887
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 109635887
NCBI-ProteinID: XP_019952922
LinkDB
Position
Unknown
AA seq 104 aa
MGDIAKGKKAFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVW
GEETLMQYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggagacattgccaagggaaagaaggctttcgtccagaagtgtgctcagtgccacaca
gtagagaacgggggcaagcacaaggttggccccaacctctggggtctgttcggacgcaag
accggccaggcagagggctactcgtacacagatgccaacaagagtaaaggtatcgtgtgg
ggcgaagagaccttgatgcagtacctggaaaaccccaagaagtacattcctggaaccaaa
atgatcttcgctggcatcaagaagaaaggagagcgccaggacctcgttgcatacctgaaa
tctgcgacgtcatga

DBGET integrated database retrieval system