KEGG   Paralichthys olivaceus (Japanese flounder): 109631395
Entry
109631395         CDS       T06037                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109631395
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109631395
   04115 p53 signaling pathway
    109631395
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109631395
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109631395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109631395
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     109631395
Peptidases and inhibitors [BR:pov01002]
 Cysteine peptidases
  Family C14: caspase family
   109631395
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 109631395
NCBI-ProteinID: XP_019946087
LinkDB
Position
Unknown
AA seq 300 aa
MAEVRGDGEKQSGGDTVDALKVFWKRSDEAITDSNKTSEEVDSTPSSKGRTAAGSDPHRY
RMDYPNIGTCVIINNKNFHSRTKMSYRNGTDVDAAFAMKTFSELGYKLIMANDQTVSQMK
TLLSNVSREDHSSSASFVCVLLSHGDEGVIYGTDGCERLENLTRNFKGDRCKSLVGKPKL
FFIQACRGSALDDGAMIETDSVDEQTSERIPVEADFLYAYSTAPGYYSWRNTSNGSWFMQ
SLCEMLMQHKGKLELMQIMTRVNRKVALHFESSSNLPGFSSKKQIPCIVSMLTKDFYFPQ
NT seq 903 nt   +upstreamnt  +downstreamnt
atggctgaggttcgtggtgatggtgaaaagcagagcggcggcgacactgtggatgcctta
aaagtgttttggaagaggtcagatgaagcgatcacagacagcaataagacgtctgaggaa
gtggactctacccccagcagtaaaggcaggacagctgcaggctcagacccccaccgctac
aggatggactatcccaacattggaacctgtgtgatcatcaacaataagaacttccacagt
agaacaaagatgagttatcgtaatggaacagatgttgatgctgcctttgctatgaagacc
ttctctgagctgggttataaactcataatggccaatgaccagactgtgagtcagatgaaa
acgctgctgtcaaacgtatctagggaggaccacagtagtagtgcatcgtttgtgtgtgtg
ttgctgagtcatggagacgagggggtgatttatggcacggacggctgtgagaggttagag
aatctgacgagaaactttaaaggggatcgctgcaaaagtctggttggcaaaccgaagctc
ttcttcatacaggcgtgtcgtggttcagccctggatgatggagccatgatcgagacagac
agtgtagatgagcaaacatcagagaggattcctgtggaggcagatttcctgtatgcctat
tccactgctccaggttactactcatggagaaacacatccaacggctcctggttcatgcag
tcgttgtgtgagatgttgatgcaacacaagggaaagctggagctgatgcagatcatgaca
cgagtcaaccgcaaggtggcgctacactttgagtcttcctccaacctacctggattcagc
agcaagaagcagatcccctgtattgtctcgatgttgaccaaagacttctactttcctcaa
tag

KEGG   Paralichthys olivaceus (Japanese flounder): 109639599
Entry
109639599         CDS       T06037                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109639599
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109639599
   04115 p53 signaling pathway
    109639599
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109639599
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109639599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109639599
Enzymes [BR:pov01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     109639599
Peptidases and inhibitors [BR:pov01002]
 Cysteine peptidases
  Family C14: caspase family
   109639599
SSDB
Motif
Pfam: Peptidase_C14 Tachystatin_B
Other DBs
NCBI-GeneID: 109639599
NCBI-ProteinID: XP_019958716
LinkDB
Position
Unknown
AA seq 284 aa
MSANGAGRAGGDSTDAERSDEQRSDGSSSAPVEVDAKAQAQSHSFRYSLKFPSIGQCIII
NNKNFDRGTGMNQRNGTDVDAANAMKVFDKLGYKVKLYNDQTVEQLKQVLLAVSKEDHSC
SASFVCVLLSHGDEGVFFGTDGSVELRYLTSLFRGDRCKSLVGKPKLFFIQACRGTDLDG
GIETDSVDDGITKIPVEADFLYAFSTAPGYYSWRNTMTGSWFMQSLCEMISKYGKVLELQ
HIMTRVNHKVAVEFVSVSNSPGFNAKKQIPCIVSMLTKEMYFTP
NT seq 855 nt   +upstreamnt  +downstreamnt
atgtcggctaacggagctggacgagcaggaggagactccacggacgcggagagaagcgac
gagcagcggtcagacgggtcttcgtccgctcctgtggaagtggacgccaaggcccaggcc
cagtcccacagcttcagatacagcctgaagttccccagcatcggccagtgcatcatcatc
aacaacaagaacttcgacaggggaacaggcatgaatcagcggaatggtacagacgtagat
gcggccaacgcgatgaaagtctttgacaagttgggttataaagtgaagctttacaacgac
cagacagtcgagcagctgaagcaggttttattagctgtgtcaaaggaagatcacagctgc
tcggcctcgttcgtctgtgtcctgttgagtcacggagacgagggcgtgttcttcggtacc
gacggctcagtggagctcaggtacctcacgtcccttttccgaggcgatcgctgcaaatcg
ctggtgggaaaacccaaactcttcttcatacaggcttgcagaggcactgatctggatgga
ggtatcgaaacagacagtgtagacgatggtattaccaagatccctgtggaagctgacttc
ctctacgccttctccacagccccaggctactactcatggaggaataccatgaccggctcc
tggttcatgcagtcactgtgcgaaatgatcagcaagtacggaaaagtgttggagctccag
cacatcatgacacgggtgaaccacaaggtggcggtagagtttgtgtctgtctccaattca
ccaggttttaatgcaaagaaacagatcccgtgcatcgtgtcaatgctgacgaaggagatg
tatttcaccccctga

DBGET integrated database retrieval system