KEGG   Paralichthys olivaceus (Japanese flounder): 109631914
Entry
109631914         CDS       T06037                                 

Definition
(RefSeq) sestrin-2-like isoform X1
  KO
K20394  sestrin 2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    109631914
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109631914
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 109631914
NCBI-ProteinID: XP_019946524
LinkDB
Position
Unknown
AA seq 556 aa
MAGNPSAGVSCKANGQKTPGRVSRRSCRLQSESESDVVPTAKSLARLCSRDEEERAAALE
ELSQGILVSLGLDKPGSARLSKRTLLHLLRLSRSCPLQEVRERAAGLLRTAQEQGVEVPR
ALASGPSAFIPAKQTLKEELDQDILIESFLSLGRVDHVTMVMALHPAYLSCFLRAQHALL
ELDGPLPCHWRHYIALMAAARNHCSYLVQQHSAGFLEAGGEESWLSGFQHAPTKLHSLQT
LNKLLAHRPWLITQQHIQELVCPGAEPRWSLAELIHAVILMAQAHSLSSFVWGCGLNPEP
DHNGGYTFRPPSPGHPPRSPHSPANEDGRQEMVEGSMEVEVLMKRMVELQQQQEEEECTQ
EEMVTRFERERSESIPTAVVRGAPPDLVLHLVEDPEFRYEDFAPRGEQAPPTMRAQDYSW
EDHGFSLVNRLLPDMGQLLDEKFQVVSTMTYHRMAMHEGVDTQTLRKALWNYIHCLYGIR
YDDYDYGSVNVLLERSLKLFVKTMACHPEQTTARIYHSFWRHFRHSEKVHANLIVMEARL
QAALLYTLRAITHYMR
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggccggtaacccctctgcaggcgtcagctgcaaggctaacggacagaagacaccgggg
cgagtgtcccgccgctcgtgtcgcctccagtccgagtccgagtccgacgttgtgccgacc
gcgaagagcttagctcgactgtgcagccgggacgaagaggagcgggcagcggctctggag
gagctgagccaggggatcctggtgagtctggggctggacaagcccggctcggcgcggctg
agcaaacggactctcctgcatctgctccgcctgtcccgctcgtgtccgctacaggaggtg
cgggagagggcagccgggctcctgaggaccgcacaggaacaaggagttgaagtacctcgg
gctctggcctccggtccaagtgcctttatccctgcaaaacagacgctgaaagaagagctg
gaccaggacattctgatcgagtcctttctttcactgggtcgtgtggaccatgtcaccatg
gtgatggccctgcaccctgcctacctcagctgcttcctgagggcccagcatgctttgttg
gagctggacggccccttgccctgtcactggagacattacattgccctcatggctgcagct
cgaaaccactgctcgtacctggttcagcagcacagtgcaggtttcctggaggctggagga
gaggagagctggctgagcggctttcagcacgctcccactaaactgcacagcctgcagacg
ctcaacaaactgctggcgcacagaccctggctcattacacagcagcacatccaggagctg
gtgtgtcctggggcggagcctcgctggtcactggctgaacttatccacgccgttatcctc
atggcacaggcccattctctttcctctttcgtgtggggctgtggcctaaacccggaaccc
gaccacaacggaggttacaccttccgacctccctccccgggtcaccctcctcgtagcccc
catagccccgctaatgaggacggcaggcaagagatggttgaaggatccatggaggtggag
gtgctgatgaagaggatggtggagctgcagcagcagcaggaggaggaggagtgcacacag
gaggagatggtgactcgttttgagagggagaggagcgagagcattccaacagcggtggtg
cgtggagctccacctgacctggtgctgcatctggtggaagatccagaattcagatacgag
gattttgcacccagaggagagcaggctccacccaccatgagggcacaggactattcgtgg
gaggaccacggcttctctctggtcaacagactgctgccagacatgggccagctgctggac
gagaaattccaggtggtgagcaccatgacataccataggatggccatgcatgaaggagtg
gacacacagactctgagaaaagctttgtggaactacatccactgcctctacgggatacga
tatgatgattatgactatggcagcgtgaacgtgttgctggagcgctctctgaagttgttt
gttaaaaccatggcctgccaccccgagcagaccacggctcgtatttaccattccttctgg
aggcacttcagacactctgaaaaggttcatgcaaacctaatagtgatggaggcccggcta
caggctgcccttctgtacaccttacgagccatcacacattacatgagatga

KEGG   Paralichthys olivaceus (Japanese flounder): 109636079
Entry
109636079         CDS       T06037                                 

Gene name
sesn1
Definition
(RefSeq) sestrin-1 isoform X1
  KO
K10141  sestrin 1/3
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109636079 (sesn1)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 109636079
NCBI-ProteinID: XP_019953155
LinkDB
Position
Unknown
AA seq 547 aa
MEVLDQEYLGRWDGLGSRDASSRTEAMENIHLEVMRKVEAIGPIPALAPLAPGLASPPNS
DLNDILAHLLMLSKRCPFDDVRERCIRLLRAVQDLGVRIPRPLGNGPSRFIPEKEILQVS
KVDTRTQLIFENAFAALGRLENISLVMGFHPQYLESFLRTQHYLLQMDGPLSLHYRHYIG
IMAAARHQCSYLVNLHVSDFLQVGGDVKWLNGLDEAPQKLQQLGELNKILAHRPWLLTKE
HIERLLKAEEHSWSLAELIHAVVLLTHYHSLASFTFGCGIMPEIHCDGGHTFRPPSLSQY
CVCDIANGNGHAYHHEDLLGNQEVCGEVEVLMERMKQLQECRDEEEASQEEMATRFEREK
TESMLVVTAEDEESVPSREISRHFEDPSYGYKDFSRKGEHVPTFRVQDYSWEDHGFSLVN
RLYPDVGQMLDEKFQMAYNLTYNTMATHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEI
NQLLDRSFKIYIKTMVCSPEKTTKRMYESFWRQFQHSEKVHVNLLLMEARMQAELLYALR
AITRYMT
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggaagtgctggaccaagagtatctcgggagatgggatggcctggggagccgggatgcc
agctccaggactgaagccatggagaacatccacctggaggtcatgaggaaagtggaggct
attgggcccataccagcactggcacccttggccccgggcttggcaagtcccccgaacagc
gatctgaacgacatccttgctcatctgctcatgctctccaaacggtgtccctttgatgac
gtcagggagcgatgcattcggcttctacgggctgtccaggacttgggagtaaggatccca
agacccttaggaaacggaccaagcagatttatccctgaaaaagagattctccaagtcagt
aaagtggataccagaacacagttgatattcgagaatgcattcgcagccctcggtcgcctg
gaaaatatttctctggtgatgggcttccacccacagtacctggagagtttcctccggacg
cagcactacctgctgcagatggacggacccctatctttgcactaccgacactacatcggc
atcatggcggcagctagacaccagtgttcctatttggtcaacctgcatgtgagtgacttc
ctccaggtcgggggggatgtgaagtggctgaatggcctggacgaggcgccgcagaagctg
cagcagctcggggagctcaacaaaatcctggcccaccgaccctggcttctcacaaaggaa
cacatcgagcgccttctgaaggctgaggaacacagctggtcccttgcagagctcatccac
gccgtggtcctcctcacacactaccactccctcgcctcgtttacattcggctgtggcatc
atgcccgagattcactgcgacggtggacacactttcaggcctccttccctcagccagtat
tgcgtgtgtgacattgccaatggcaacggccatgcttatcaccatgaagatctgcttgga
aaccaggaggtgtgtggcgaggtcgaggtgctgatggagcgcatgaagcagctgcaggag
tgccgcgacgaagaggaagccagccaggaggagatggcaacccgcttcgaaagggagaag
acagagagtatgctggtggtcacagcggaggacgaggagtctgtcccctccagggaaatc
tctcgacactttgaggaccccagctatggctacaaggacttctctaggaagggggagcac
gtgcccacgttcagagtgcaggattacagctgggaggatcatggcttctctctggtcaac
cgactgtatcctgatgtgggtcagatgctggacgagaagttccagatggcctacaacctg
acctacaacaccatggcaacgcacaaggacgtggacaccagtatgctgcgtagggccatc
tggaactacatccactgcatgtttggcatcaggtatgatgactatgattatggagaaata
aaccagcttctggaccgtagctttaagatctatatcaagaccatggtgtgtagtcctgag
aagaccaccaaacgaatgtatgagagtttctggaggcagtttcagcactccgagaaggtc
catgttaatttgcttcttatggaagcacgaatgcaagcagaactgttatacgctctgaga
gcgatcacccgctacatgacatga

DBGET integrated database retrieval system