KEGG   Paralichthys olivaceus (Japanese flounder): 109631953
Entry
109631953         CDS       T06037                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04060  Cytokine-cytokine receptor interaction
pov04068  FoxO signaling pathway
pov04144  Endocytosis
pov04218  Cellular senescence
pov04350  TGF-beta signaling pathway
pov04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109631953
   04350 TGF-beta signaling pathway
    109631953
   04068 FoxO signaling pathway
    109631953
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109631953
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109631953
  09143 Cell growth and death
   04218 Cellular senescence
    109631953
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109631953
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109631953
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109631953
Protein kinases [BR:pov01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   109631953
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase APH Pkinase_fungal RP854
Other DBs
NCBI-GeneID: 109631953
NCBI-ProteinID: XP_019946595
LinkDB
Position
Unknown
AA seq 601 aa
MEEQRSFVSLRGALCVFFLAALLETGAAAWSSGFGVQEAGLNRSQQSEREVMPPSYPLSQ
LCKFCDLELSMCSGTGTCMSNCSITSICQDSNEVCVAIWRKNDTGFSIETLCHNPSKPLY
GVMLDDYNSSTCVMKEKNTTSGMAHFCSCTEEECNDKLLFSPIVDPTPDHTLVSVILVSL
LPLLVMGIMFAGMLYWYRTYRKRALNQEWSNIKNRKLRLDCSDACAIMMDDDRSYSSSTH
ANNLNHNTEPLPIELDALVGKGRFAQVFKAKLKQTTSDQFETVAVKIFPYEEYASWKNEK
DIFSNTDLRHENILHFLTAEEKKVEKQYWLITAFHPRGNLQEYLTRHVISWEELQVLGSS
LARAVAHLHSDRLACGRPKVPIVHRDLKSSNILVKNDLTCCLCDFGLGLCLDSSLTVDDL
ANSGQVGTARYMAPEVLEARLNLENTESFKQTDIYSMALVLWEITSRCEAVGEVKDYEPA
YGSKVREHPCVESMKDNVLRDRGRPEIPDTWLRHQGVAVICATIKECWDHDPEARLTAHC
VAERISIMEDEIDKLSSRSSSAEKITEELKIAVELEIPEKEVKITEIQDIIPMDCSVTDE
K
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggaggaacagcgcagttttgtatctttacgcggagctttatgtgtcttcttccttgct
gcgctgctggagaccggggctgctgcttggagcagtgggtttggagtccaagaggcaggt
ctgaacaggtcacagcagagcgagcgagaggttatgccgccttcttaccctttgagtcag
ctctgtaagttctgtgatctggagctgtccatgtgtagtgggacagggacctgcatgtcc
aactgctccatcacgtccatctgccaagacagcaacgaggtctgtgtcgctatctggagg
aagaatgacacaggcttctccatcgaaactctctgccacaatccgtccaagccgctgtat
ggtgttatgctggatgactacaacagctccacctgtgtgatgaaggagaagaacacaacg
agtgggatggctcacttctgctcctgtactgaagaagagtgtaacgacaagctgttattt
tcccctattgtggatccaactccagatcatacgttagtgtccgtgatcctggtgagcttg
ctgcccctgctggtgatggggatcatgtttgcaggaatgctctactggtaccgaacctac
cgtaaacgcgcgctcaaccaagaatggagtaacattaagaaccgcaagctaaggctggac
tgcagcgacgcctgtgccattatgatggatgatgacaggtcttacagcagctcgacccac
gccaacaacctgaaccacaacactgagccactgcccatagagctggatgcgctggtgggc
aaaggtcgctttgctcaggtattcaaggcaaagctgaagcagacaacctcagatcagttt
gaaactgtggctgtgaagattttcccctatgaggagtacgcttcctggaagaacgagaag
gacattttctccaacacggacctccgacacgagaacatcctgcacttcctgacagcagag
gagaagaaggtggagaagcagtattggctcatcactgcgttccacccgagaggaaatcta
caggagtatctaacacgtcatgtgatcagctgggaggagctgcaggttttgggcagctct
ctcgctcgggctgttgctcatctccatagtgaccgccttgcctgtggacgccctaaggtg
cccatcgtccaccgtgacctgaagagctccaacattctggtgaagaatgacctgacatgc
tgcttgtgtgactttggcctgggactctgcctggacagcagcctgactgtggatgacctc
gccaacagtggacaggtgggtacagcacgttacatggctccagaggttctggaggcccga
ctcaatctggagaacactgagtccttcaaacagactgacatttactctatggcactggtg
ctgtgggagataacatcgaggtgtgaagctgttggagaggtgaaagactatgaacctgcg
tatggctctaaagtacgagagcacccctgtgtggagagcatgaaggacaatgtgctgaga
gacagaggacgacctgagatcccagacacctggctcaggcatcagggtgtggcggtgatt
tgcgccacgataaaggaatgctgggaccacgaccccgaggcccgactcacagcgcattgc
gttgcagaacgcatctccataatggaggacgagattgacaaactttccagccgcagctcc
tcagcggagaagatcactgaggaactgaagatcgcggtagagttggagatcccagagaaa
gaagtgaaaatcacagaaatacaggatatcatccctatggactgctccgttactgacgag
aagtga

DBGET integrated database retrieval system