KEGG   Paralichthys olivaceus (Japanese flounder): 109632037
Entry
109632037         CDS       T06037                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00230  Purine metabolism
pov01100  Metabolic pathways
pov04020  Calcium signaling pathway
pov04114  Oocyte meiosis
pov04261  Adrenergic signaling in cardiomyocytes
pov04270  Vascular smooth muscle contraction
pov04371  Apelin signaling pathway
pov04540  Gap junction
pov04912  GnRH signaling pathway
pov04914  Progesterone-mediated oocyte maturation
pov04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109632037 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109632037 (adcy3)
   04020 Calcium signaling pathway
    109632037 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109632037 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109632037 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109632037 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    109632037 (adcy3)
   04916 Melanogenesis
    109632037 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109632037 (adcy3)
   04270 Vascular smooth muscle contraction
    109632037 (adcy3)
Enzymes [BR:pov01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109632037 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA OPA3 fn3_4 DUF4400
Other DBs
NCBI-GeneID: 109632037
NCBI-ProteinID: XP_019946689
LinkDB
Position
Unknown
AA seq 1044 aa
MFAMPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTF
TPESLENLYQTYFRRQRHETLLVLVVFAALFDSYIIVMCAVVYTTDKLASVLVASVGLAA
DIILYLLCRFSLLPDRISRRVVPYALWVLIAAQIFCYLGLNYARFHQASDTVGWQAFFSF
SFFLTLPLRLTPIVLITAVSCGVHTLVLGVTIAQQQQEDIQAAALGRQLLANIVIYVCAI
TVGVMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKK
EPSQKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAK
YHQLRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHS
GTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDVEPGNGGD
RCDYLRERGIETYLVVVPKGPVGKSGINGVKLSVTSSNGNSPLLINTTECNGNANTACTT
PEEPEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQAVF
PKKLVSFSTWIDHTRWARNTWAMAAIFILTMADIVDMLSCLPRVPDSGGATTAPSSAPSS
SSTWSGPHGCLENPKYYSYIAVLALMATTMLVQVSHMVKLTLMLLITVSTGIVNIYSWRD
IFDRYDTARFQDYRSYLVPSKFTMTTMIFIMMVSFYYFSRHVEKLARTLFLWKIEVHEQK
EKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASIPNFSDFYTE
ESINNGGIECLRFLNEIISDFDSLLDEPQFRCITKIKTIGSTYMAASGVTPDVSNGYTCM
KKEEQSDRERWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGLNKGGVLAGVIGARKP
HYDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYGFRFVRRGPIFVKGKGELLTYFL
KGRDKQGSFINGSSVTLPHQVVDS
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgttcgccatgcctcggaaccgagccttttctgaaccagagtactcagcggagtactca
gcggactgctccgtgacattgccgtccgaccccgggcaggctgtggggcgaacacatgag
gtcacggttcggagctcaggatgctgcctctgtctgccgcggtttatgcgcctcaccttc
acaccagagtccctggagaacctctaccagacttacttcaggcggcagagacatgaaacc
ctgctcgtgctcgtcgtgtttgctgctctctttgacagctacatcatcgtcatgtgtgcg
gtggtctacaccactgacaagctggcttctgttctagtggcatcagtgggactggcagca
gatattatcctctacctgctgtgccgcttcagcctgctgccagaccgcatctccagacgg
gtggtgccctacgccctgtgggtgctcatagcagctcagatattctgctatctgggttta
aactatgctcgcttccaccaggccagcgacactgtgggctggcaagctttcttcagcttc
tccttcttcctgactctgcctctgaggctgacgcccatcgtgctcatcactgctgtatcc
tgtggggtccacactctcgttctgggtgtcaccattgcccagcagcagcaggaggacatc
caggcggcagcacttggcagacagctgctggccaacattgtgatctatgtttgtgccatc
actgtgggtgtcatgtcatactacatggctgaccggaagcatcggaaggcctttctggag
gcaagacagtcactggaggtcaaactcaacttggaggagcagagccaacaacaggaacgc
ctgctgctttccatcctcccaaagcacatagctgacgagatgcttcaggacatgaagaag
gagcccagtcagaaagagatgcagcagttcaacactatgtacatgtacagacatgaaaat
gtcagtattctgtttgcagacatcgtgggcttcacccagctgtcgtcatcctgcagcgct
caggagctggtcaaactgctcaatgagctcttcgcacgctttgacaaactggcagcaaaa
tatcaccagctgaggatcaagatcctgggagactgctactactgtatctgtgggctgcca
gactacagggaggaccacgctgcctgctccatcatgatgggcctggccatggtggaggcc
atctcgtacgtccgagagaaaacccagacagatgttgacatgcgggtcggagtgcacagt
ggcacagtcttgggaggagtgctgggtcagaaacgctggcagtacgatgtctggtccaca
gatgtcactgtggctaacaaaatggaagcaggagggataccgggtcgtgtccacatctca
cagagcaccatggagtgtcttcacggcgagtttgacgtggagccagggaacggaggggac
cgctgcgattacctgagggagaggggcatcgagacctacttggtggtggttcctaaagga
cctgtgggaaagagtggcatcaatggtgtcaagttgtctgtaacctcctccaacggaaac
tcgccgctgttaatcaacaccacagagtgtaacggcaatgctaacacagcctgcaccaca
ccggaggaaccagaagaactggacacaagggtggtgaatccgtctttcccaaaccctcgg
agaagactgcggctgcgggacctggctgagagggtgattgatgctcaggagaatgaacag
gagctcaacaaactactcaacgaggccctgctggagagagagacagtacaggcggtcttt
cccaagaagctggtgtctttttccacctggattgaccacacccgctgggctcgcaacacc
tgggccatggcagccatctttatcctgaccatggcagacatcgtggacatgctcagttgt
ctgcctcgagtcccagactcaggcggcgccaccacagctccctcctccgctccttcctcc
tcctccacttggtctgggcctcacggatgcctggaaaaccccaaatattacagctacatt
gctgtgctggcactgatggctaccaccatgctggttcaggtcagtcacatggtcaagctc
acactgatgctgctcatcactgtgtccactggcatcgtgaacatctacagctggagggac
atcttcgaccgctacgacacggcccgcttccaggactacaggtcatacctggtgccttcc
aagttcacaatgacaactatgatcttcattatgatggtcagcttctattatttctccaga
catgtggagaagcttgcccgcaccctgttcctgtggaagattgaggtccatgagcagaag
gagaaagtatacgagatgaggcgctggaatgaagcactggtgaccaacatgctgcctgaa
cacgtggctcgacacttcctgggctccaagaaaagggacgaggagttgtacagccagtcc
tacgacgagattggagtcatgtttgcctcaatccccaacttctctgacttctacacagag
gagagcatcaacaatggagggattgaatgcttacgcttcctcaacgagatcatctcagat
tttgacagtctgctggatgaacctcaattccgctgcattacaaaaatcaagaccatcggc
agcacctacatggcagcatcaggcgtcaccccagatgtcagcaatggctacacttgcatg
aagaaggaggagcagtctgacagagagcgctggcagcacctggcagacctggctgacttt
gctctggctatgaaggtcacactcatgaacatcaactaccagtcattcaacaacttcatg
ctacgcatcggtctgaacaagggtggagtgctagcaggagtgattggtgcccgcaaaccc
cactatgatatctggggcaacactgtgaatgtggccagtcgcatggagtccacaggggtg
atgggaaacatccaggtggtggaggactgctacaacatcttgaaggagtacggcttccgc
tttgtgaggagggggcccatctttgtgaagggaaaaggggagttgctcacttattttcta
aagggaagagacaaacaaggctcatttatcaatggctcctctgtcactctgccacaccag
gtggtggacagctaa

DBGET integrated database retrieval system