KEGG   Paralichthys olivaceus (Japanese flounder): 109632693
Entry
109632693         CDS       T06037                                 

Gene name
apaf1
Definition
(RefSeq) apoptotic protease-activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109632693 (apaf1)
   04115 p53 signaling pathway
    109632693 (apaf1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109632693 (apaf1)
SSDB
Motif
Pfam: WD40 APAF1_C ANAPC4_WD40 NB-ARC CARD Ge1_WD40 WD40_like CARD_2 Utp8 AAA_16
Other DBs
NCBI-GeneID: 109632693
NCBI-ProteinID: XP_019947675
LinkDB
Position
Unknown
AA seq 1141 aa
MALEEGARSCLLRFRHRLEEDIKASYLMDHIISDGVMSVDEEERIRTQPTRKDQAVALLE
LLLRKDNRAYISFYNALVKEAYDDLANMLHDDLPQVSENAHKSYSDGCTSYVVLSEGGVP
QRPVVFVSRPELLNRVREKLYRLKNEPGWVTIFGMAGSGKSVLAAEAVRHQGVIEECFPG
GIHWLSIGQLDKPDLLVKIQSLCFRLEQHLEQHLDTQSLHRPLNSLDEAKERLRFLMLRR
YPRLSCLDHPDVLFSSPLVVSLIGALLKEKPNRWRYYLCQLQQKQFKRIRKSSSYDYDAL
DQAMAASIEVLPDEHRELYKDLTVMEKDIKIPAKVLSVLWDLELEEVEDILEEFVNKSLL
FVDTHNKPCLYYLHDLQLDFLVEQNRAQLESLHSKVVRQYQQHYRNGPPISGDEECLYWI
RFLTYHMAKANLTQELYSLMFSLDWVSIKAKIMGPAHLINDYVEYGPILDKENSEVRSQF
QEFLSLNGHHLEQRPFPDVVQLALSQPHSSDVYKQALLQAQHRASEGQLYFDWLNKSSVE
TLSRLVIHPHQGSIYSACFSHDGAKIATCGASKTLKVFRSTTGEKLTEIQAHDDEVLCCA
FSPDDRLLATCSSDRKVKVWNVERAMLLRVFAVEHEEQVNHCQFTNTRRQLLLATCSDDK
LLNVKLWNLNRPSSQNAMFGHFEPVNHCCFSPDDTYLSTSSNDGTVKLFQVSSANEWKTI
NVNSMFTESDEAILVKCSTWTADGKRIACAARNSVLVFDVETSDMLLEIKTNRLSTVQYC
HACPTSNLLAIAFSNYAVELWDLESNKKMADCSGHLSWVQCVQFSDDGSQLLSCSDDQTV
RLWETKKVHTTSAVCLKRDSDVLFCDEEITVSAADNCNRLQVRDGKTGSVLFQSEEQSSR
IRCTCLCKQPSAVALGQEDGTVKVLEVPSGKLLATLLGHTKTVLHCQFSQNGQTLITSSE
DTTIRVWRWQSGEGRVLQGHREQVRCFSRLNSSEADTRLLSWSYDGTVKVWDIESGEKLQ
DINAHQGAILSCHVSPDGCLFATTSADKTAKLWRCESWQCLHTLSGHQDCVRSCRFSWDS
QCLATGDDNGEIRWWDVERGEALQTFYPAGSALKRIHVSSDFSTFVTIDGIGILYILQRV
V
NT seq 3426 nt   +upstreamnt  +downstreamnt
atggcgctggaggaaggggcgcggagctgtctgcttcgctttcgccacagactcgaagaa
gacatcaaggcctcgtacctgatggaccacataatcagtgatggtgtcatgagcgtagat
gaggaggagaggatcaggactcagcccaccagaaaggatcaggctgtggctctgctggag
ctgctgctgcggaaggacaaccgtgcctacatctccttctacaacgccctggttaaggag
gcatatgatgatttggccaacatgcttcacgatgaccttccgcaggtctcagaaaatgca
cacaagagctactctgatggttgcacatcttatgtggtgctgagtgaaggtggtgttcca
cagaggcctgtggtgtttgtcagcagaccggaacttttgaaccgggtaagagagaaactc
taccggctgaaaaatgaacctggctgggtcaccatcttcggaatggctggctcaggcaaa
tctgtactggccgcagaggctgtcagacaccaaggtgtcattgaagagtgcttccctgga
ggcatccactggttgtctatcggccagctggacaaaccagaccttctggtgaagatccag
tcgttgtgtttccgcctggagcagcacctggagcagcacctggacacacagtctctccac
cgccccctcaactctctggatgaagccaaggagcgcctgcgcttccttatgctgcgcaga
tacccaaggttgtcatgcttagatcatcctgatgtacttttcagctcccctctggtggtg
tccttgatcggggccctgctcaaggagaaacccaaccgctggcgttactacctctgccag
ctgcagcagaagcagttcaagcgtatacggaagtcctcatcttatgactacgacgccctg
gaccaagccatggctgcgagcatcgaggtcctgcctgacgaacatcgagagctctacaag
gacctcactgtgatggagaaggacattaaaatcccagctaaggtgttgtctgttctgtgg
gacctggagctggaggaggtggaggacattctcgaggagtttgtcaacaagtccctgctt
tttgtggacactcacaacaaaccctgcctgtattacctccacgatcttcagctggacttc
ctggtggagcagaaccgtgcccagctcgagagtcttcactctaaagtggtgcgtcagtat
cagcagcactacagaaacggtcctcccatctcaggagacgaggagtgtctttattggatc
agatttctgacgtaccacatggctaaagccaaccttacccaggagctctactccctcatg
ttttctctggactgggtcagcatcaaggccaagataatgggtccagcgcacctcatcaac
gactatgtggagtatggaccaattctggacaaagagaacagcgaggtgcgcagtcagttc
caggagttcctgtctctgaacggccaccacctggaacagcgtcctttccccgacgtggtg
cagctcgctctgtctcagccacactcatccgatgtctataaacaggctctgctgcaggca
cagcaccgggccagcgagggacaactctactttgactggctgaataagagcagtgtggag
actctctcccgtctggtgatccaccctcaccagggctccatctactctgcctgcttctcc
catgacggagccaagatcgccacctgtggagccagcaagacactcaaggtgtttagaagc
accacgggcgagaagctcacagagatccaggcccacgatgatgaggtgctctgctgcgcc
ttctccccggacgaccgtctcctagcaacctgctctagtgacagaaaagttaaggtttgg
aatgtggagcgagccatgctgctgagggtctttgcggtggagcacgaagagcaggtcaac
cactgtcagttcacaaacacgagacggcagctcctcctggccacctgctccgacgacaag
ttattgaatgtcaagttgtggaacctcaacagaccgtcctcccagaacgccatgtttggg
cactttgaaccagtcaaccactgttgtttctcccctgatgacacctatctgtccacttct
tccaacgatggcactgtgaagctatttcaggtgtcgtccgccaacgagtggaagacgatc
aacgtgaacagcatgtttaccgagagcgatgaagccatcctcgtcaagtgcagcacctgg
actgcagatggcaaacgtatcgcatgtgccgccaggaacagtgttttggtgttcgatgtg
gagacgtcagacatgttgttggagatcaaaacaaatcgtctgagcaccgtgcagtactgt
cacgcctgtccgaccagtaacctgctcgccattgccttctcaaactacgctgtggagctg
tgggacctggagtccaataaaaagatggctgactgcagtggacacctgagttgggtccag
tgtgtccagttctctgatgacggatcacagctgctctcgtgctccgatgaccagactgtc
aggttatgggagactaagaaggttcacaccacctctgccgtctgtctgaagagagactct
gacgttctcttctgtgatgaagaaatcaccgtatcggctgccgacaactgcaacaggctg
caggtacgtgatggcaagacgggatcagtgctgttccagtcagaggagcagtcgtccagg
atcaggtgtacctgtctgtgcaagcagccctctgcagtggctctgggacaagaggatgga
acagtaaaggtgttggaagtgccctctgggaagcttctggccactctgctgggacatacg
aagacggtgctgcactgccagttcagccagaacggccaaaccctgatcacatcctccgag
gacaccaccatcagggtgtggaggtggcagtctggcgagggtagagtactccagggtcac
agagagcaggtcaggtgcttctctcggctcaacagctcagaggccgacacaagactgcta
tcctggtcctacgacggtactgtcaaggtgtgggacatagaaagtggagagaagctgcag
gacatcaacgctcatcagggagccattctgtcctgtcatgtctctccagacggttgcttg
ttcgccaccacctctgctgacaagactgctaagctctggcgctgtgagtcctggcagtgc
ctccacacgctaagcggtcaccaagactgtgtccgaagctgcagattctcctgggacagc
cagtgcctcgcgactggggacgacaacggagagattcggtggtgggatgtggagcgaggc
gaggccctgcagaccttctatccagctggaagcgctttgaagaggatccacgtgtcgtcc
gacttctccaccttcgtcaccatcgacggcattggcatcctctacatcctccagagggtt
gtgtga

DBGET integrated database retrieval system