KEGG   Paralichthys olivaceus (Japanese flounder): 109632701
Entry
109632701         CDS       T06037                                 

Definition
(RefSeq) uncharacterized protein LOC109632701
  KO
K05461  KIT ligand
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109632701
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109632701
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pov04052]
    109632701
Cytokines and growth factors [BR:pov04052]
 Growth factors
  Growth factors (RTK binding)
   109632701
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 109632701
NCBI-ProteinID: XP_019947684
LinkDB
Position
Unknown
AA seq 253 aa
MRKKILKAPCLLLSLFTSLNLCSGKFGTPITDDVSKLSLLKQNIPSDYEIPVSYIPKEVA
GPCWVVLNIYPLEQSLRKLASMFGAISSNKENIIVFIAMLKSLRFTFDHEELETTMQVFQ
CHYRDGSLMSGLYFDYIKDILHAAAQGTSGFSCKPPPCLNPHQTPGGQEDTRVYSWSKRA
PVLLALIPFIACVVLIVWQVRSGRRLPVCNTENNRTPSSDTIASVSVSIPLQTLTHAADT
QPAGEAMPEHESG
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatcttgaaagcaccttgtctcctcttgagtctgttcacaagtttgaat
ctctgctctggaaaattcgggacgccgataactgatgatgtgagcaagctgtctttattg
aagcagaatatcccgtctgattatgaaattcctgttagttacattcccaaagaagtggct
ggcccgtgctgggtggtgttaaacatctatcctttagagcaaagtcttcgaaagctggcc
agcatgttcggtgccatctcctccaacaaggaaaacataatcgtcttcattgcgatgctg
aagagtttacgcttcaccttcgaccatgaggagctggaaactacaatgcaagtcttccag
tgtcactacagagatgggagcttaatgtccggtctttacttcgactatatcaaagatatc
ttacacgccgccgctcaggggacatccggcttctcgtgcaagccaccaccgtgtctcaat
ccacatcagacaccaggtggtcaggaagacactcgtgtatacagctggtccaagagagcg
cccgtgctcctggctctcatccccttcatagcctgtgttgttcttatagtgtggcaggtc
aggtctggaaggcgcttaccagtgtgcaacaccgaaaataaccgaacgccatcttctgac
acgattgccagtgtgtctgtctccatcccacttcaaacactcacccacgctgccgacact
cagccagcgggggaggcgatgcccgagcatgagagtggatga

DBGET integrated database retrieval system