KEGG   Paralichthys olivaceus (Japanese flounder): 109632862
Entry
109632862         CDS       T06037                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04020  Calcium signaling pathway
pov04260  Cardiac muscle contraction
pov04261  Adrenergic signaling in cardiomyocytes
pov04270  Vascular smooth muscle contraction
pov04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109632862
   04020 Calcium signaling pathway
    109632862
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109632862
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109632862
   04261 Adrenergic signaling in cardiomyocytes
    109632862
   04270 Vascular smooth muscle contraction
    109632862
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pov04040]
    109632862
Ion channels [BR:pov04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109632862
SSDB
Motif
Pfam: Ion_trans GPHH CAC1F_C Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 109632862
NCBI-ProteinID: XP_019947929
LinkDB
Position
Unknown
AA seq 2073 aa
MTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYL
RNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGV
PSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMSKMHKTCFHEHIGTIAEEKP
APCAPEGAYGRHCNQNGTECKMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWM
QDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEE
DLKGYLDWITQAEDIDPENEEEGMDDDKPRNLSMPASENESVNTDNAPGGDVEGETCCTR
LANRISKSKFSRYSRRWNRLCRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHQQPQWL
TDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMS
PLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQL
FGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFI
ILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARLASPEKRHNNEKPP
LQEKKEKIELKSITSDGETNTATKINMDDYCGDESEEKNPYPANDYIGDEDDEEPEMPVG
PRPRPLSDIQLKEKAIPMPEARAFFIFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSIS
LAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFVHKGSFCRNYFNILDLVV
VSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVT
TLLQFMFACIGVQLFKGKFFFCTDTSKQTQAECRGSYIMYKDGDVGKPKRAHRLWENSDF
NFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPVYNYRVVISIFFIIYIIIIAFF
MMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVV
NSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPR
GYFSDPWNVFDFLIVIGSIIDVILSEINGLQNSEENARISITFFRLFRVMRLVKLLSRGE
GIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDHTQINRNNNFQTFPQ
AVLLLFRCATGEAWQEIMLACSPNQPCEKGSTNENSSTHEDCGSQFAIIYFVSFYMLCAF
LIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQ
PPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEEL
RAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPP
KTALSLQAGLRTLHDIGPEIRRAISGDLTVEEEMDKGLKEPVSAASEDDIFRVKRTGGLF
GNHVNYYNQSDGRVSFPQSFTTQRPLHISQKGSPCEGSNANINNANNTGMVGVATQGVSR
FPSPSISTVDGHTGQPLTPILLPRSAWCFPPKSSDSSDSHLPIIRRGEDSTEETYDESYV
DDMEYHEDDHSLSSDMLVYHDETCKQLTPMEEGEEVEDRRGGGGWQSPRRVFLCPTSLGR
RSSFHLECLRRQSRPDVSQKTAVPLHLVHHQALAVAGLSPLLRRSHSPTLFSRLCSTPPA
SPTAHGSDASYQRVPSLRLEGSNSHEKLNTSLPSVNCGPWYSDSNGNSRGPSPSPTPSGS
VSNQRAPRPVSLTVPSLLGKDSCSLSHGSAGSLVEAVLISEGLGHFAQDPSFIEATKAEL
ADACDMTIEEMEHAANNILNSNNTTTTTTTTNVTSSTSSNSQNSPNGNLLPFQTAAASTH
RDRVGSLSPSEGGGEAGGSRSSVHEPSSMEERQELLAEGRGQEEEEEEEEEEEEQEAEER
EEGHHRGSVVIAGTRQRNSGLLEDEDMECVTSL
NT seq 6222 nt   +upstreamnt  +downstreamnt
atgaccatttttgccaactgtgtggccttagctgtctacatccccttccctgaggatgac
tcgaacgccaccaactccaacctggagcgtgtggagtatctgttcctcatcattttcacc
gtggaggcgttcctgaaggtaatagcctatggcctgctcttccaccccaatgcatacctg
aggaatggctggaatctgcttgacttcatcattgtagtcgtaggattattcagcgcaatc
ttggagcaggccaccaagggagacggggccactcccattggagggaaagcagcgggcttc
gatgtcaaggctctgagggcatttagagtactcagacccctcagactggtgtctggagta
ccaagtttacaggtagtgttgaactccataatcaaagccatggttcctctgctccatatc
gccctgctggtcctctttgtcatcatcatctatgccatcatcggcctggagctcttcatg
agcaagatgcacaagacctgctttcatgagcatataggcaccattgcagaggaaaagcct
gcaccatgtgcacctgaaggggcttatggtcgacactgtaatcagaacggaacagagtgc
aaaatgggatgggagggcccaaatgacggcattaccaacttcgacaactttgcctttgcc
atgttaacggtgttccagtgtataacgatggaaggctggacagacgtgctatactggatg
caggatgctatgggctatgagctgccgtgggtctattttgtctctctcgtcatcttcggc
tcctttttcgttctcaatctcgttctgggggtgttgagcggagagttttccaaggaaagg
gagaaggccaaggctcgcggtgacttccagaaactcagagaaaaacaacaactggaggag
gacctcaagggctatttagactggatcactcaggctgaagacattgacccagagaatgag
gaggagggcatggatgatgataaacccagaaatctgagcatgccagccagcgagaatgaa
tcagtcaacacagacaatgcccctgggggagacgtggagggtgagacctgctgtacccgg
ctagcaaataggatctccaaatccaagttcagtcgctactctcgaaggtggaacaggcta
tgcagaagaaagtgccgggcggcggtcaaatctcaagttttctattggttggtcatcttc
ctggttttcctcaacacactcaccattgcctctgaacatcaccagcagcctcagtggtta
acagacgtacaggacatagccaataaggtgttgctagcactcttcactggtgagatgctg
ttgaagatgtacagtctgggcctacaggcgtactttgtttcgctctttaaccgctttgac
agctttgtagtatgtggaggaatcctggagaccattctggtggaaaccaagatcatgtct
cctctcggcatctctgtgttacgttgtgtgcgcttgctacggatcttcaaaataaccaga
tactggaactcactgtccaacctggtggcctccctgctaaactctgtccgctccatcgct
tcgctgttgctcctgctcttcctcttcatcatcatcttctccctgctcggcatgcagctc
tttggggggaaattcaacttcgacgagaccagacgcagcaccttcgacaactttccccag
tctctgctcaccgtgtttcagatcctaacaggagaggactggaactctgtaatgtacgat
ggcatcatggcgtatggtggaccgtccttccctggcatgctggtctgcatctacttcatc
atcctcttcatctgtggaaactatatcctgctgaatgtcttcttggccatcgctgtcgac
aatctggcagatgctgagagcctgacatccgcccagaaagaagaggaggaggagaaagag
aggaagaaactagccaggctggccagtccagagaaacgccacaataatgagaagccgcct
ctgcaggagaagaaggagaaaatagaactgaagtctatcacttcagatggagagaccaac
accgctactaagatcaacatggatgactactgtggagatgagagtgaagagaagaatcca
tatcctgcaaacgattacataggtgacgaggatgacgaggagccagagatgccggtgggg
ccaaggccacggccactttccgacattcagctgaaggagaaggccattcccatgcctgag
gctcgtgctttcttcatcttcagccacaccaacaaattcagggttctgtgccataagatc
gtcaaccacaacatcttcaccaacctcatcctcttcttcatcctgctgagcagcatcagt
ctggcagcggaagacccggtgaagaacgactctttcagaaaccagatcttgggctatgca
gatcatgtcttcactggactcttcaccatagagatcattcttaagatgacagcatatgga
gccttcgtccacaaaggttcattctgtagaaactattttaacattctagacctggtggtg
gtcagtgtgtccctcatctcatctggaatacagtccagtgccattaatgtggtgaagatc
ctgagagttctgcgagtgctcagaccgctgagagccatcaatagagccaagggcctaaag
catgtggtgcagtgcgtgtttgtggccatcaggaccatcggcaacatcgtcatcgtcacc
acgctgctccagttcatgtttgcctgtattggagtacagctttttaagggcaagttcttc
ttttgtacggacacctccaaacagactcaagctgaatgcaggggttcctacatcatgtat
aaggatggagatgtgggaaagcctaaaagagcccacagactgtgggagaacagtgacttt
aactttgatgacgtcctgcaaggcatgatggctctgtttgctgtgtctacctttgagggc
tggccagggttactgtatcgggccatagactctcacgccgaggatgtcggacccgtttac
aactatcgggtggtcatctccatcttcttcatcatctacattatcatcattgccttcttc
atgatgaacatattcgtcggtttcgtcatcgtcaccttccaggagcaaggagagcaagag
tataagaactgtgaactggacaagaaccagcgtcagtgtgtggagtatgccttgaaggcc
cgtccattgcgccgctacatccctaagaacccctaccagtacaaggtgtggtatgtggtc
aactccacctactttgagtacctgatgttcacactcatcctcctcaacaccatctgtctg
gccatgcagcatcatggacagaccaaaaatttcaatgacgccatgaacatcctcaacatg
ctcttcactggactcttcactgtggagatgatcctgaaactgattgccttcaaaccaagg
gggtactttagtgatccctggaatgtgtttgatttcctcatcgtaattggcagcataata
gacgtcattctcagtgagatcaacggactgcagaactctgaagagaacgccaggatctcc
atcaccttcttccggctgttccgcgtgatgaggctggtgaagctgctgtctcgcggggaa
gggattcggaccctgctgtggaccttcatcaaatccttccaagctctgccatacgtagct
ctgcttatagtgatgctattcttcatatacgctgtcatcggcatgcagatgtttggtaag
atagcgctgcgggaccacacgcagatcaacaggaacaacaatttccagacgttccctcag
gcagtgttgctgctcttcagatgtgcaactggtgaggcgtggcaggagatcatgctggcg
tgctcgcccaatcagccatgtgagaagggatccaccaatgagaacagctcgacacacgag
gactgtggcagccagtttgccatcatttactttgtcagcttctacatgctctgtgccttt
ctgatcatcaacctgtttgtggctgtcatcatggacaactttgactacctgacgcgtgac
tggtcgatcctggggccgcatcatcttgacgagttcaagaggatctgggctgaatatgac
ccagaagccaaggggaggataaagcatcttgatgtggtgactctgctccggagaatccag
cctcccctcggctttggaaagctttgtccccacagagttgcctgcaagcgtctagtgtca
atgaacatgcctctgaacagcgatggaactgtaatgttcaacgccacactgtttgccctg
gtcagaaccgcactcaggattaagacggaaggtaaccttgagcaggccaatgaggaactg
agggcaattgtgaagaagatctggaagagaaccagcatgaagctcttagatcaagtggtg
ccccctgctggtgatgatgaggtaacagtcgggaagttctacgcaaccttcctcatccag
gaatatttccgcaagtttaagaagaggaaagaacaagggctggtggccaaggtgcctccg
aaaactgccctctctctgcaggcgggcctgcggacgttgcacgatattggtccagagatt
cggagggccatctctggagacctgactgtggaggaggagatggataaaggcctgaaggag
cctgtgtcggctgcatctgaggacgatatcttcagggtaaagcgaacgggtgggttgttc
ggcaaccatgtcaactactacaaccagagtgatggccgcgtgtccttcccacagtccttc
actacccagcgtcccttgcacatcagccagaagggctcaccttgcgaaggctcaaacgcc
aacatcaataacgccaacaacaccggcatggttggagttgcaacccagggtgtcagtcga
ttccccagcccgtctataagcactgtggacggacacacaggacagccactcacccccatc
ctgctgccaagatctgcgtggtgctttcctccaaagagctcggactcaagtgacagccat
ctgccaatcatacggagaggggaggattcgacggaggagacgtatgatgagagctatgtt
gacgacatggagtaccacgaggatgaccactcgctctcttctgacatgcttgtgtatcat
gatgaaacatgtaagcagttgactcccatggaggaaggagaggaggtagaggacagaaga
ggaggaggagggtggcagtctcccaggagagtcttcctctgtcccacttcactggggcgg
agatcgtccttccatctggagtgtctcaggagacagtcaaggccagacgtctcccagaag
acagctgtgcccttacacctcgtacatcatcaggcgctggcagtggcagggttgagtcct
ctgttaagaaggagtcactcacccaccctcttcagccggctgtgctccacgcctccagcc
agtcccacagcccatggcagtgatgcctcctaccagcgagtgccctctctgaggctagag
ggctcaaactcccatgaaaagctcaataccagcttaccctctgtcaattgtgggccctgg
tacagcgacagtaatgggaacagccgagggcctagtcccagtcccacccccagcgggtca
gtttccaatcaaagagcaccacggccggtgtcgctcacagtgccctcgctactgggaaaa
gactcctgctcactgtctcatggcagcgcaggcagtctggtggaggcggtgctaatatca
gagggtttgggtcatttcgctcaggacccgtcattcatcgaggcaaccaaagccgagttg
gctgatgcctgtgacatgaccatcgaggagatggagcacgccgccaacaacattctcaac
agcaacaacaccaccaccactaccaccactacgaacgtcacgtccagcacctcctctaac
tcccagaacagccccaatggcaacctcctccccttccaaacagcagcagcatcaacgcac
agggaccgagtgggcagcttgagtcccagcgagggcgggggagaggcaggaggaagcaga
agctccgtccatgagccgtcctctatggaggaacggcaggagctgctagcagaggggaga
ggacaggaggaggaggaggaggaggaagaggaggaggaggagcaagaggcagaagagagg
gaggaggggcaccacagaggctcagttgtaattgcaggtacgcggcagaggaacagcggg
ctgttggaggacgaggatatggagtgtgtgacgagtttgtag

DBGET integrated database retrieval system