KEGG   Paralichthys olivaceus (Japanese flounder): 109633589
Entry
109633589         CDS       T06037                                 

Gene name
rchy1
Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109633589 (rchy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109633589 (rchy1)
Enzymes [BR:pov01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109633589 (rchy1)
Ubiquitin system [BR:pov04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    109633589 (rchy1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-RING_5 zf-C3HC4_2 Prok-RING_4 zf-RING_4 Trypan_PARP
Other DBs
NCBI-GeneID: 109633589
NCBI-ProteinID: XP_019949140
LinkDB
Position
Unknown
AA seq 275 aa
MAAAAGCEHYVRSCLLKAPCCGKLYVCRLCHDAEEHHQMDRFKVREVQCSECLTVQQAQQ
TCQQCHVQFGEYYCDICHLFDKDKEQYHCQPCGICRIGPREKYFHCDKCNLCLAQDLQGN
HKCVENVSRQNCPVCMEDIHTSRIGAHVLPCGHLLHKTCFDDMVRTGAYRCPLCMHSACD
MEDHWDQIDVEIAQSPMPTEYQGATVKIICNDCQAHCTVPFHVLGMKCSGCGSYNTAQEG
GLIQQLQPPQQQQPEPEIEDETETDTEPEQQDQPE
NT seq 828 nt   +upstreamnt  +downstreamnt
atggctgccgccgcagggtgtgagcactatgtccgcagctgcttattgaaagccccctgt
tgtggtaaactgtacgtgtgtcggctgtgccatgatgcagaggaacaccaccagatggat
cgattcaaagtccgagaggtgcagtgctccgagtgtctgactgtgcagcaggcacagcag
acttgccagcagtgtcatgtgcagttcggggagtattactgtgatatttgtcacctgttc
gacaaggataaggagcagtaccactgtcaaccttgcggaatatgcaggattggccccagg
gagaaatatttccattgtgacaagtgcaatctgtgtttagctcaggatctacagggaaac
cacaagtgtgttgaaaatgtgtcaaggcagaactgcccagtgtgtatggaggatattcac
acgtccagaattggcgctcacgttctaccatgtggtcatctgttacacaagacctgcttt
gatgacatggtcagaacaggagcgtatcgctgccctctgtgtatgcactccgcctgtgac
atggaggaccactgggatcagatcgacgtagagatcgctcagtcaccgatgcccactgaa
taccagggggctactgtcaaaattatatgtaatgactgccaagctcactgcacggtgcct
ttccatgtgctgggcatgaagtgcagcggctgtggctcctacaacacggcacaggaggga
ggactcatccagcagcttcaaccaccacaacaacaacagccagagccggagattgaggat
gagacagaaacagacacagagcccgagcagcaagatcaacctgagtaa

DBGET integrated database retrieval system