KEGG   Paralichthys olivaceus (Japanese flounder): 109633942
Entry
109633942         CDS       T06037                                 

Definition
(RefSeq) myosin light chain kinase, smooth muscle-like isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04020  Calcium signaling pathway
pov04270  Vascular smooth muscle contraction
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109633942
   04020 Calcium signaling pathway
    109633942
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109633942
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109633942
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109633942
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109633942
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     109633942
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   109633942
SSDB
Motif
Pfam: Pkinase I-set PK_Tyr_Ser-Thr Ig_3 ig Ig_2 fn3 V-set RIO1 Ig_6 Kinase-like Ig_C17orf99 Pur_ac_phosph_N Kdo
Other DBs
NCBI-GeneID: 109633942
NCBI-ProteinID: XP_019949701
LinkDB
Position
Unknown
AA seq 881 aa
MNGDGSKQSFVSTFRMQIKPARASSSSSSSSSSPSSGPGTANTRPSDKCTDRGSLNLSSA
KHLDPPVFIEHLEDCYVDEGSDIRLRGVLTGSQPIKVSWLHNGEVARFGKPSFNGREVSF
VVTECLPEDAGAYICMASNRAGTTSCSSAVCVRDFETICGVQNWVSKIPTSASKSIMKNG
RSPSPPTDELQEFGGSTCTSPPVSDKQRTVSSPREVIPKKRADSGKGATLHFENPPQHLK
VKVGQTARLLSRFSGSPPLVSCWINNKEQIVDGPELWTENTDQSSTLVIAETKPQHTGCY
TIVVRDRKSSAQNTITLSVIERPEPPASSPVISRVSATSLVLSWSGPCYDGGSAILGYVV
EVKKRGSAEAGDWSKLTAQCRSTSYRVSAGLPPGEQYCFRVRAYNAVGVSEPGPVSPVVK
MEQEDSDKLQEEEALQAYTCVSIDSSHKVTDHYVLQEKLGMGKFGLVFKLTDKETGRVCA
GKFYKGRRAKEREAARKEIELMNYLHHPKLVHCLAAYDHKPEMVMVMEFIAGGELFERIV
DDSFEHTEPASVHYMQQILEGIAYMHEQNIIHLDLKPENIVCIDTIGTSIKIIDFGLASK
FDPNTPLKVMHGTPEFVAPEVINYEPVCLATDMWSIGVICYILLSGESPFQGDSDTETLA
SVTAAHWEFDEESFEEITDEAKNFISSLLNKDTRRRMSCVEALAHPWMAAFDSGDCANTK
CLSKEKMKRFLARQKWKKAGKAMLALTRMTLLSKGESSGSPTSSGGGSPLSPEAEHALEY
LEKKMQGPPHFTQCLEDQTVARGSSACLSCHLTGYPDPEVVWLCGKEPIVETPTVQIEYE
EDGRCTLVLAKVEATDANIYTCRATNEHGEACCSANLTVQE
NT seq 2646 nt   +upstreamnt  +downstreamnt
atgaacggcgatggcagcaaacagagttttgtatcaaccttcaggatgcagatcaagcca
gcacgtgcatcatcatcatcatcatcatcatcatcttcacccagcagtgggccaggaact
gctaacaccaggccctcggacaaatgcactgatagaggttctctcaacctctcctctgcc
aaacatctggatccacccgtcttcatagagcatctggaggactgctatgtggacgaggga
agtgacatcagactgcgcggggttctcacagggagtcagcctatcaaagtgtcatggttg
cacaatggtgaagtggcccgttttgggaaaccctctttcaatggcagggaggtgagtttc
gtggtgacggagtgtctgccggaggatgctggagcctacatctgcatggcttcgaacaga
gcagggacgacgtcctgcagctctgccgtgtgcgtcagagactttgaaactatctgcggt
gtgcagaattgggtctcaaagatcccaacttctgcatccaaaagcattatgaagaatgga
aggtcaccgtcacctcccacagatgagctgcaggagttcggaggatctacttgtacctct
cctccagtgtctgacaagcagagaacggtctcatctccgagagaagttataccaaagaag
agagctgactcagggaaaggtgcaacactgcattttgagaaccccccacagcacctcaag
gtgaaggtgggacagaccgcccgtctgttgtctcggttcagtggcagcccccctctggtg
tcctgttggatcaataacaaagaacagatagtggatggtccagagctgtggacagaaaat
acagatcagagcagcacactggtgatagcagagaccaaaccacagcacacaggttgctac
actattgtagtgagggaccgaaagagctcagcgcaaaacacgatcacactttctgtaata
gagaggccagagcctcctgcctcttcccccgtgatctcccgtgtctctgccaccagcctg
gtgctgtcctggtccggaccctgctacgacggtggcagcgccatcctgggttatgtggtt
gaggtaaagaaacgtggaagtgctgaggccggggactggagcaaactcactgcccagtgt
aggagtacttcatacagagtgtctgctgggctgccccctggagagcaatactgtttcaga
gttagggcctacaacgcagtgggagtaagcgaaccaggaccagtgtcacctgtggttaag
atggagcaggaagattcagacaaactgcaagaagaggaggcccttcaggcgtacacctgt
gtctctattgactcttcccacaaagtcacagaccactatgttttgcaggagaaactggga
atgggaaagtttggcctggtgttcaaactaactgacaaagagacgggacgagtgtgcgct
gggaaattttacaaaggccgacgtgccaaggaaagggaggctgctcgtaaagagatagag
ttgatgaactatctccaccaccccaaactggttcattgtctggcggcctacgatcacaag
cctgagatggtcatggtcatggaatttatcgcaggtggggaactgtttgaacgtattgta
gatgacagctttgaacacacagagccagccagtgtgcactacatgcagcagatcctggag
gggattgcgtatatgcatgagcaaaacattatccacctggacctcaaacctgagaacatt
gtgtgcattgacaccattggtacctccataaagattattgacttcggattagccagcaag
tttgatccaaacacgcctctgaaggtaatgcatgggactccagagtttgtggcaccggaa
gtgataaactatgagcctgtgtgtttagccactgacatgtggagcattggagtgatctgc
tacatattactgagtggtgagtctcctttccagggagacagcgatacagagaccctggcc
tcggtcacagctgctcattgggaatttgatgaggagagctttgaggaaataacagatgag
gccaagaatttcatcagttcactgctcaacaaggacaccagacggaggatgtcctgtgta
gaggccctcgcccacccttggatggcagcatttgactctggagattgtgccaacaccaag
tgtctgtccaaggagaagatgaagaggtttctggccaggcagaagtggaagaaagcaggt
aaggccatgcttgccctgacgagaatgactttactatccaaaggcgaaagctctggatct
ccaaccagctctgggggaggctcaccccttagcccagaagcagagcatgccctcgagtat
ctggagaagaagatgcaggggccaccgcacttcacccagtgtctggaggaccagacagtg
gctcgaggatccagtgcctgtctctcatgccacctcacaggataccccgaccctgaggtg
gtgtggctgtgtggaaaggagcccatagtggagacaccaacggtgcagatagagtatgag
gaagacggccgatgtaccctggtccttgccaaagttgaggccacggacgccaatatttac
acctgtagagccaccaatgagcatggggaggcgtgctgctcagccaacctcactgttcaa
gagtag

KEGG   Paralichthys olivaceus (Japanese flounder): 109637330
Entry
109637330         CDS       T06037                                 

Definition
(RefSeq) myosin light chain kinase 2, skeletal/cardiac muscle-like isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04020  Calcium signaling pathway
pov04270  Vascular smooth muscle contraction
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109637330
   04020 Calcium signaling pathway
    109637330
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109637330
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109637330
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109637330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109637330
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     109637330
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   109637330
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr HSBP1 Kdo DUF1664
Other DBs
NCBI-GeneID: 109637330
NCBI-ProteinID: XP_019955170
LinkDB
Position
Unknown
AA seq 796 aa
MSALIVNTEGDDSGVSFDLIQNRIESLSSKMDKLINIQEKVLNRLDGMSQDIDGIEKDME
NLKVDKEEIHLPPRMVSQTQVVGREVKEICQEMSTIMSVVNQRSEQQAQKLEGMEKLVLS
MQQVIGFIGETVKSSKIMELILKGPTAQKGCKPKDNKGKQATKKKTSTDAITKKLDKKTT
SNKTSKGNQQITPACEPSSPQPSHKIKLHGPKHFLASRKCGKCMKDHKAKDGTEKPCLSP
QSHKAQKRMKPPDTADNISLKKQVLLLEEVQKLNRENVEKSDHQLTPGYLDLEAGVSPKD
QQVDASTCNLVDYLQEDSQVAEKCGATSDKVAEEEAVVTEQEPKLDVEEAVKEDEEEKKE
EEASAAEEEEIPAEKEPTATSPDDHRDASPAEQDQKAERSSSTAQTFVTEEHFLVEEPTN
SQVLEEEERGDREEDVQKLETEGWAVFRADGVEIQLNLKQRLERERKENDAEEEEDDDAE
RYFIDTTPPPAAPFNHRIVSAKPNQISNFYTINWQEVLGGGRFGQVHKCVENSSGLTLAA
KVIKARAQKEKEVVKNEILVMNNLDHASLIQLYAAYESRNDIILVLEYVGGGELFDRIID
ENYTLMELDAVGFIRQICEGLQHMHKMYILHLDLKPENILCVSRITNKIKIIDFGLARIY
KPREKLRVNFGTPEFLAPEVINYDFVSFNTDMWSLGVITYMLLSGLCPFLGDDDNQTLNN
ILACQWNFEEQEFVDTTEEAKDFISKLLIVNKSWRMGASEALRHPWLSDSVLHHRLNTKK
TMCRSRRSSCVPTTDS
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgagtgccttgatagtgaacacagagggagacgacagcggcgtaagctttgacctcatc
caaaatcggattgagtcactgagcagcaagatggacaagctcatcaacattcaagagaag
gtgctgaaccgcctggatgggatgtctcaggacattgacggcatcgaaaaggatatggag
aatctaaaggttgacaaggaggagatccatctgccgcccaggatggtgagccagacccag
gtcgtggggagagaggtgaaggagatatgccaggagatgagcaccatcatgtcggtggtg
aaccagcgctccgagcagcaggctcagaagctggaggggatggaaaaactggtcctcagc
atgcagcaggttatcggcttcattggggagacggtgaagagttcaaagattatggagctg
atactgaaaggccccacagctcagaagggctgcaagcccaaagacaataaaggaaagcaa
gctaccaagaaaaaaacgtctacagacgcaataaccaagaagctggacaagaaaactacc
tctaataaaaccagtaaagggaatcaacagataactcctgcatgtgagcccagttctccg
cagccttctcacaagataaagctccacggaccaaagcatttcctcgcctctcgcaaatgt
ggaaaatgtatgaaagaccataaagctaaagacgggacagagaagccttgtttgagccca
cagagtcacaaagctcaaaagaggatgaagccccctgacacagcagataatatctccctg
aagaagcaagttctgcttcttgaagaggtgcagaaactcaacagggaaaatgtagagaaa
tcagatcaccagctcacccccggatatctggatctggaggccggagtttcccccaaagat
caacaagtcgatgcttccacttgcaatttagtggactacttgcaagaagattcccaggtg
gccgagaaatgtggggcaacgagtgacaaggtagctgaggaagaggcggtggttacagag
caggaacccaagcttgatgtggaggaggctgtgaaagaggatgaagaggaaaagaaggaa
gaggaagcttcagctgcagaagaagaagagatccctgctgaaaaagaaccaactgctaca
agccctgatgaccacagagatgcttccccagctgagcaagaccagaaagcagagaggagc
agctcaactgcccagacctttgtgactgaggagcactttttggtggaggaacccacaaat
agccaggtgttagaggaggaggagagaggagacagggaggaggacgtacagaagctggag
actgagggctgggctgtgttcagggcagatggagttgaaatccagttaaacctcaaacag
cggctggagagggagaggaaggaaaacgatgcagaggaggaggaggacgacgatgctgag
cggtactttattgacaccactcctccaccagcagctccttttaatcaccgcattgtatcg
gccaagccaaaccagatcagcaacttctacaccatcaactggcaggaggtccttggaggg
ggccgttttggccaagtgcacaaatgtgtcgaaaactcttcaggtctcactttggcagcg
aaggtcatcaaagccagggcacagaaagaaaaggaggtggtgaagaatgagatcctggtc
atgaataatctggaccatgccagcctgatccagctctatgcagcttatgagtcaaggaat
gacatcatccttgtacttgaatatgttggtggaggggagctgtttgacaggatcattgat
gaaaactacactttaatggagcttgacgctgtggggttcatcaggcagatctgtgagggc
ctgcagcacatgcacaaaatgtacatcctgcacctggacctaaagccagaaaatattctg
tgtgtgagccgaattacaaataagatcaaaatcatcgactttggcctcgccaggatatat
aaaccgagggagaagctgcgagtgaattttggcaccccggagtttcttgctccggaagtc
atcaactacgactttgtgtcgttcaacacagacatgtggagcctcggcgtcatcacatac
atgcttctcagtggtctctgccccttcctcggtgatgacgacaaccagactctcaacaac
atcttggcctgtcagtggaactttgaggaacaagagtttgtagatacgacagaagaagcc
aaagatttcatctccaagctccttattgtaaataaaagttggaggatgggggcgtctgag
gcattgagacatccttggctttctgactcagtgcttcatcatcgccttaatacaaagaaa
actatgtgcagatcacggcgatcgtcatgtgtgcccacgaccgatagttga

KEGG   Paralichthys olivaceus (Japanese flounder): 109639205
Entry
109639205         CDS       T06037                                 

Gene name
mylk4
Definition
(RefSeq) myosin light chain kinase family member 4
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04020  Calcium signaling pathway
pov04270  Vascular smooth muscle contraction
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109639205 (mylk4)
   04020 Calcium signaling pathway
    109639205 (mylk4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109639205 (mylk4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109639205 (mylk4)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109639205 (mylk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109639205 (mylk4)
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     109639205 (mylk4)
Protein kinases [BR:pov01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   109639205 (mylk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like DUF4541
Other DBs
NCBI-GeneID: 109639205
NCBI-ProteinID: XP_019958112
LinkDB
Position
Unknown
AA seq 629 aa
MSSSLVNSLARVYDPNPLHGQKPGGRKSSFNGYQASSSSSSHDAALHCMESRMDSLSSQM
ERLLNMQQTVLTRLDSLSQDVRGMGQDLASMREEGHGGRRESGVEVTCRELHGAVERASE
RIESHGHRLDGVEKLVEGTQQVINFIGEVVKNSRLVELLFKQPGNNASKKAKDEKDKAKL
SQKGLKAQKKRKPQDSSDSVALNEPVLQEQVEKLNRQNAEHSHVNAEAEAQRGDDRGIGG
RRQEPGELILDGPHTSASQSGERQTTTEGREEEEEGEEDVFEDSEPGDEEEKGENARAEP
AGKVEDDGKKRHKGDAEESEKAPSVIADICKKPLVQQESSEEVGDVATCSKRRVTEEDLV
KDDLKKSKVENADGEAAVEKGEQQEVKSDEAKPEQEEEAKDSERTVEEFIIDSSPPPLAP
FEHCIVTPKPHQIGTYYTINRDEVLGGGRFGQVHKCTENSSGLTLAAKIIKARSQKEKEV
VRNEIQVMNQLNHANLIQLYAAFESRHDIILVMEYVEGGELFDRIIDENYNLTELDTVLF
IRQICEGLQYMHKMYILHLDLKPENILCVSRATNKIKIIDFGLARRYKPREKLKVNFGTP
EFLAPEVINYEFVSFPTDMWSLGVITYML
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgagctccagtctggtcaactcgttagccagggtttacgatccaaaccctctccatggt
cagaaacccggtggacggaagtcctcttttaacgggtaccaagcttcttcatcttcctct
tctcatgatgccgccctgcactgcatggagagccgcatggactccctgagctctcagatg
gagcgcttgctcaacatgcagcaaactgtcttgacccggctggacagtctgtcccaggat
gtcaggggcatgggtcaggatctggcctccatgcgtgaagagggccacggcggaaggcgg
gagtcaggggtggaggtaacgtgcagggagctgcatggcgcagtggagagggccagcgag
cggattgagagtcatggacaccggctggacggggtggagaagctggtggagggcacccag
caggtgatcaacttcatcggggaggtggtgaagaactccaggctggtggagctgctcttc
aaacagcctggaaacaatgcaagcaagaaggcaaaggatgagaaggataaagccaaactg
agccagaagggtctgaaggcccagaagaagaggaagccccaagattcgtcagattcagtc
gccctgaacgagcctgtgctgcaggaacaggtggaaaagctcaacaggcagaacgctgag
cattctcatgtgaacgcagaggctgaggcccagagaggagacgacagaggcatcggagga
agacgacaggagccgggggagctgatcctggatggacctcacacctcggcctcacagtca
ggggagaggcagacgaccactgaggggagagaggaggaagaggagggggaggaggatgtc
tttgaggactccgagccgggagacgaagaggaaaagggagaaaacgctagagcagaacca
gctgggaaagtggaggatgatgggaagaaaaggcacaaaggagacgcagaggagtcagaa
aaggccccgagtgtcatcgcagacatttgcaagaagcctctcgtacaacaggagagctct
gaggaggtcggggatgtggccacctgcagcaagcgccgcgtcacggaggaagacctggtg
aaggacgacctcaaaaagagtaaggtggaaaacgcagacggagaggcggcggtggagaag
ggcgagcagcaggaagtcaaatcagacgaagcaaagccggagcaggaagaggaggcgaaa
gactcggagcggacagtggaagaattcattatcgactccagtcctccgccgttggccccg
ttcgaacattgcatcgtgacgcccaaaccccatcagataggcacctattacaccatcaac
agggatgaagtcctgggagggggacgtttcggacaggtccacaagtgcacagagaactcg
tcgggtctgacattggccgccaagatcatcaaagcgaggagccagaaagagaaggaggtg
gtcaggaacgagatccaggtgatgaaccagctgaaccacgccaacctcatccagctgtac
gccgccttcgagtcacgccacgacatcatcctggtcatggaatatgtggaggggggggag
ctgttcgaccgcatcatcgacgagaactacaacctgacggagctggacacggtgctgttc
atacggcagatctgtgagggactgcagtacatgcacaagatgtacatcctgcacctcgac
ctcaagccagagaacattctctgtgtgagcagagccactaacaagataaagatcattgac
ttcggtctggcccggaggtataaacccagggagaagctcaaggtcaactttggaacgccg
gaattcttggcccctgaagtcatcaactacgagtttgtttcatttcccaccgacatgtgg
agcctgggtgtcatcacatacatgctatga

DBGET integrated database retrieval system