KEGG   Paralichthys olivaceus (Japanese flounder): 109634096
Entry
109634096         CDS       T06037                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04080  Neuroactive ligand-receptor interaction
pov04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109634096
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109634096
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pov04030]
    109634096
G protein-coupled receptors [BR:pov04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109634096
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 109634096
NCBI-ProteinID: XP_019949935
LinkDB
Position
Unknown
AA seq 426 aa
MIQSHLKLHHHHHHRSPRHHQSHQHHQHQRRFLQRGASCLDGENSDTHIGVMESNMSSNC
YYSNNVTFFYQRVGKSISSGWTTRDYVVIGLGLTVCFIVALANLMVMVAIFMNRRFHFPI
YYLLSNMAAADLFAGIAYANLMLNTGPWTSTLTKKQWYIRGALIDISLTASVANLLAVAV
ERHQTILTMQLHSKMSKRRVTLLIVCIWAVGIVMGLVPSMLWNCECHLDDCSTVAPLYSR
RFLVFWAILNLLTFFIMVAMYTRIFIYVRYQSLYTSQHSSEHRRTVFNLMKTISMVLGAF
VICWTPGLVILLLDGLLGRRSHANVYEKFCLVIAECNSLVNPIIYSLRDEEMRSTFKRIV
CCLCWRGGGRQREPPAEEIDSPSPEVTIVPVRLNESLNCVEKSDDQTCSQDTNKREDSWT
MNEIST
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgattcagtctcacctgaagctgcaccaccaccaccaccaccggtccccccgccaccac
cagtcccaccagcaccaccagcaccagagacgctttctgcagcgaggagcttcatgtctg
gatggagaaaactctgacacacacatcggggtcatggagagcaacatgtccagcaactgc
tactacagcaacaacgtcaccttcttctaccaacgggtaggcaagagcatcagctcgggg
tggacgacgcgggactacgtggtgatcggactgggcctgacggtgtgtttcatcgtcgcg
ctggccaacctcatggtgatggtggccatcttcatgaaccgccgcttccacttccccatc
tactatctcctgagcaacatggcagcggcggacctgtttgccggcatcgcttacgccaac
ctgatgctgaacacgggcccctggaccagtacgctcaccaagaagcagtggtacatccga
ggggccctgatcgacatcagcctgacggcgtctgtggccaacctgctggccgtcgccgtg
gagcgccaccagaccatcctcaccatgcagctgcacagcaagatgagcaagcgccgggtg
acgctgctgatcgtctgcatctgggccgtgggcatcgtcatgggcctggtgccctccatg
ctgtggaactgcgagtgtcacctggacgactgctccaccgtcgctcccctctacagccgc
cgcttcctcgtcttctgggcgattttgaacttgctcacattcttcatcatggtggccatg
tacacccggatcttcatctacgtgagataccagagcctgtacacgtctcagcacagctcg
gagcacaggcggactgttttcaacctgatgaaaactatctccatggttttaggcgccttc
gtgatctgctggacccccggcctcgtgatcctcttactggacgggcttcttggtagaaga
agccacgccaacgtctacgaaaagttctgtctggtgatagccgagtgcaactctctggtc
aatcccatcatctattccctgcgagacgaggagatgcggagcacgttcaagaggatcgtg
tgctgcctttgttggaggggtggcggccggcagagggagcctccagctgaggagatagac
tctccatcaccagaagtaactattgttccagttagacttaatgaatctctcaactgtgtc
gagaaatcagatgatcagacttgttctcaagacaccaacaaaagagaagacagttggaca
atgaatgaaatatcaacctag

DBGET integrated database retrieval system