KEGG   Paralichthys olivaceus (Japanese flounder): 109634199
Entry
109634199         CDS       T06037                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04217  Necroptosis
pov04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109634199 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109634199 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109634199 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pov03000]
    109634199 (stat3)
Transcription factors [BR:pov03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109634199 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 AP1AR Syntaxin-6_N
Other DBs
NCBI-GeneID: 109634199
NCBI-ProteinID: XP_019950073
LinkDB
Position
Unknown
AA seq 784 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMDIARIVARCLWEEQRLLQTAT
TAAQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQATATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFADIIMGYKI
MDATNILVSPLVYLYPDIPKEEAFGKYCRPEAAPEPEIGGDSTSTIQPYLKTKFICVTPC
PSVFMDLPDSELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAEANPGHLDSLTLDMDV
ASPM
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggcacagtggaaccagttgcagcagctggagaccaggtatctggagcagctctaccac
ttgtacagtgacagcttccccatggagctccggcagtttcttgccccctggattgagagc
caagactgggcttacgctgccaataaggagtcacacgctacactggtgtttcacaacctc
ctgggagagatagatcagcagtatagccgtttcctgcaggaaaacaacgtgctctaccag
cataacctccgcagaattaaacagcatctgcagagcaagtacttggaaaagccaatggat
attgcacgcattgttgcccgctgcttgtgggaggagcaaaggctcttgcagactgcaacg
actgctgcacaggatggtcaggcagctcatcccactggtacagtagtgacagagaagcag
cagatcctggagcacaaccttcaagacattaggaaacgagtgcaggatatggagcagaag
atgaaaatgcttgagaacttgcaggatgatttcgacttcaattataagacactgaaaagc
caaggagagttgtcccaggaccttaatggaaatagccaggcaactgctacaagacagaag
atggctcagcttgaacagatgctgagcgctttggaccagctcaggaggcaaattgtgacc
gagatgggaggcttgctgactgccatggattatgtgcagaagaacctgacagatgaagaa
ctagcagactggaagagacgacagcaaattgcttgtattgggggtccgccgaacatctgc
ctggatcgcctcgagacatggatcacatccttggctgagtcccagctccagattcgtcag
cagatcaagaagttggaagaacttcagcagaaagtgtcctacaaaggagaccccatcatt
cagcaccgacctgccctggaggagaagattgtggacttgttccgaaacctaatgaagagt
gcttttgtcgtggaaaggcaaccctgtatgcccatgcatccagacagacctctggttatt
aaaacaggagtgcagttcacaaataaagtcaggttacttgttaagtttcctgaactgaat
taccagctgaaaattaaagtttgcattgacaaggaatctggtgatgtggctgcaattcga
gggtcacgaaagtttaacatcctcggcaccaacacaaaagttatgaacatggaggaatcc
aacaatggcagcctgtcagcagagtttaaacacttgaccctgagagaacagaggtgcggt
aatggtggccggaccaatagtgatgcctctctgattgtcacagaggagctgcatcttatc
acttttgagacagaagtctaccaccaaggtctgaagattgatctggagactcattctctt
cctgtggtagtcatttcaaacatctgccagatgcccaatgcctgggcctccatcctgtgg
tacaacatgctcactaaccacccaaagaatgtaaacttcttcaccaagcctccagtggga
acatgggaccaggttgctgaggtgctaagctggcaattctcctccaccaccaagagaggc
ctgaccattgaacagctcaccacactggctgagaaattactagggccttgtgtcaactac
tctggctgtcagatcacttgggccaagttctgtaaggaaaacatggctggtaaaggcttc
tccttctgggtgtggctggacaacatcattgacctggtgaagaagtatatcctggcactg
tggaatgagggatatatcatgggatttatcagtaaggagagggagagggccattctgagt
ccaaaacctcctggcacctttcttctgcgcttcagcgagagcagcaaagaggggggcata
acattcacatgggtggagaaagacatcagtggaaagacccagatccagtcggtggagccc
tacaccaagcagcagctcaacaatatgtctttcgccgacatcatcatgggctacaagatt
atggatgccaccaacatcctggtctcacctctcgtctacctctaccctgacatccccaaa
gaggaagcgttcgggaagtactgcaggccagaggcagctcctgaacctgagataggagga
gactcaacaagcactattcagccatacttgaagacaaagttcatctgcgtcactccgtgt
ccctccgtgttcatggacttgccggacagtgagctgcttgggaacggattcccaggcaca
aattctggaaacaccagtgacctgttccccatgtcaccccgcaccctcgactctctgatg
cacaacgaagcagaagctaatccaggacatttggattcgctgactttggacatggacgta
gcttcacccatgtga

DBGET integrated database retrieval system