KEGG   Paralichthys olivaceus (Japanese flounder): 109634432
Entry
109634432         CDS       T06037                                 

Gene name
tmem25
Definition
(RefSeq) transmembrane protein 25
  KO
K22652  transmembrane protein 25
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Brite
KEGG Orthology (KO) [BR:pov00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pov04515]
    109634432 (tmem25)
Cell adhesion molecules [BR:pov04515]
 Immunoglobulin superfamily
  TMEM25
   109634432 (tmem25)
SSDB
Motif
Pfam: C2-set_2 Ig_3
Other DBs
NCBI-GeneID: 109634432
NCBI-ProteinID: XP_019950472
LinkDB
Position
Unknown
AA seq 381 aa
MSTKIIFQCFNSSFLAPTIQHYSPTGAIEPAPKIDGWHRAAVTLQENTTHRFNCQSDGWD
PHAPPLLTWYLNGERQGAPSPNRGRLVMTSQEDSVLMRPGTNHNSTFSLQARKWDRELVC
VASNPRTGESYNATVTINVQFQPEILRVNAHYTETSDPGLSLILFALVRSNPPATITFVD
QSGHLVANTSDFFILDSRSYPWLTNHTLRVTLSSLSGNLSLNASNSVGAVQNNLTLAEFL
QSRVEVPMLGIVTGGAMAFMALLILSLIVLCLMQKNKSKSIDEPVEILMTKKSYSANLKV
EKDDKTFIPRENMSLPSNMQLNDLSTLRKAREAAQHNSVGEKKEEEEEDLSLAYAARGFA
RYPMVGYIYKVNSTSSEEIWL
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgtctaccaagatcatttttcaatgttttaattcatcatttctggccccaacaatccaa
cattactcccccacaggagcgattgagcccgccccaaaaattgatggatggcaccgggca
gcagtgacactgcaggagaacacgacacatcggtttaactgccaatcggacggctgggat
cctcatgctcctcctttgctgacttggtacctgaatggggagcgacagggagcgccgtcc
cccaaccgtgggcgcctggtgatgacatcacaggaagattctgtgctcatgagaccagga
accaatcacaacagcaccttctctctgcaggccagaaagtgggacagggagctagtgtgt
gtagcatcgaacccccggacaggagagagttacaatgccacagtcacaatcaacgtccag
tttcagccagagatcctcagggtgaacgcccactacactgaaacctcagaccccggcctg
tccctgatcctctttgccctggtacggtccaacccacctgccaccatcaccttcgttgac
cagtctggccatctggtggccaacacctccgacttcttcatcctggactcgcgcagctac
ccctggctgaccaatcacacgctgagggtgacgctcagtagcctatcagggaatttatcg
ctgaatgccagcaacagtgtcggagcggtgcagaacaatctcacactagcagagttcctg
cagtctcgtgtagaggtgcccatgctgggaatagtgactgggggagccatggcgttcatg
gccctcctcatcctcagtctaatcgttctctgcctcatgcaaaaaaacaaaagcaagtcc
atcgacgagccagtggagattctgatgaccaagaaaagttactctgccaacctgaaagta
gagaaggacgataagaccttcatcccaagagagaacatgtctctgccttccaacatgcag
ctcaacgacctcagcactttgagaaaagcccgagaggctgcccagcacaacagtgtggga
gagaagaaggaagaggaggaggaagatctgtctttagcctacgccgccagaggttttgcc
agatatccgatggtgggctacatctataaggtcaacagcacaagcagcgaggagatctgg
ctctga

DBGET integrated database retrieval system