KEGG   Paralichthys olivaceus (Japanese flounder): 109634457
Entry
109634457         CDS       T06037                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B2-like isoform X1
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04114  Oocyte meiosis
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109634457
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109634457
   04114 Oocyte meiosis
    109634457
   04115 p53 signaling pathway
    109634457
   04218 Cellular senescence
    109634457
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109634457
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pov03032]
    109634457
   03036 Chromosome and associated proteins [BR:pov03036]
    109634457
DNA replication proteins [BR:pov03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109634457
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109634457
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109634457
NCBI-ProteinID: XP_019950502
LinkDB
Position
Unknown
AA seq 401 aa
MARTGVSDPKPLLDLHKRADERRAPLRAWANACGPIDRWQPVEVEESRKVPVKVEPECRW
ERRLLTQTSEGIIMGFNEDSQTHSDGSGMDVEGCVEEHMLLYPHGLQSLHSLQALVPSLL
RHEVETALEKLGLIRDRTYAWEMFLVMMRTQTRSSFPNTDLPRHFTDATRAVLVDWLVQV
HEMMHFQEETLYLAIHLVNCSLRQIKVTTTNLQLLGMVCLFIAAKKEECLLPEVSGLCYL
MDHTYTKHHLLRMERKVLCGLKFDLSYCPPLHFLLLFASIARCSAKVVWMARYLLELSLL
EGQCVVFLPAQLAGASLCLSRQVLQEPPTPEGGAAWCLASSIHVGSETALLAIMHILANA
AAKAHTRETCATFIKFSSPETMHVSRHQGLKNASALLGVRS
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggccaggaccggcgtctccgaccccaagcccctgctggacttacacaagagggcggat
gaaaggcgagccccgttaagagcgtgggctaatgcctgtggaccaatagatcgctggcag
cctgtagaagtagaagagtccaggaaggtgcctgtcaaagtggagccagaatgcagatgg
gaaaggaggttattaacgcaaaccagtgaaggcatcatcatgggattcaatgaagacagt
cagacgcactcagacggtagtggaatggatgttgagggatgtgtggaggagcacatgctt
ctttaccctcatggcctgcagagtctccacagccttcaggcgctggtacccagcctgctg
cgccatgaagtcgagacagcgctggagaaactgggccttatacgggaccggacatacgcc
tgggaaatgttcttggtcatgatgagaactcaaacacggagctcttttcccaacactgac
ctgccgcggcatttcaccgatgccactcgagctgtgctggtagactggctagttcaagtt
catgaaatgatgcatttccaggaagagaccctctatctggccatacacctcgtcaactgc
tctttgcgtcagatcaaggtgacaacaaccaatctgcagctccttggcatggtctgcctc
ttcattgctgcgaagaaagaagagtgtctcctccctgaggtgtctggactctgctactta
atggaccacacctacacaaagcatcatctgctgcgaatggagcgtaaagtcctctgtggg
ctcaagtttgatttgtcctactgtccccctctgcacttccttctcctttttgcctccatc
gctcgctgcagtgcaaaggtggtgtggatggctcggtacctgctggagctctctctgctg
gagggccagtgtgtggtgttcctccctgcacagctggctggggcctccctctgcttgtcc
cgccaagtcctgcaagagccaccgacaccagagggaggggccgcctggtgtctggcctcc
agtatccatgttggcagtgaaactgccctgctggcaatcatgcacattctggccaacgct
gcagccaaggcccacacaagagagacctgtgcaacttttattaaattctcctccccagag
accatgcacgtcagcagacaccagggtctgaagaacgcctctgcccttctgggtgtacgc
tcttga

KEGG   Paralichthys olivaceus (Japanese flounder): 109640910
Entry
109640910         CDS       T06037                                 

Gene name
ccnb1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04114  Oocyte meiosis
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109640910 (ccnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109640910 (ccnb1)
   04114 Oocyte meiosis
    109640910 (ccnb1)
   04115 p53 signaling pathway
    109640910 (ccnb1)
   04218 Cellular senescence
    109640910 (ccnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109640910 (ccnb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pov03032]
    109640910 (ccnb1)
   03036 Chromosome and associated proteins [BR:pov03036]
    109640910 (ccnb1)
DNA replication proteins [BR:pov03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109640910 (ccnb1)
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109640910 (ccnb1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109640910
NCBI-ProteinID: XP_019960703
LinkDB
Position
Unknown
AA seq 403 aa
MALRVTRNRLASTRTDLPGKSCSVTGPTLKPRAALGEIGNVAVKEVQRKNIKTEAAKKTK
VTKVEKTVAVVEPPKAPKNVVPVKPEPEVQVLPEPVSPTPMETSGCEPRDLCQAFSDVML
ETAVRDVDADDYDNPMLCSEYVKDIYKYLRQLEVEQNVRLHYLQGHEVTGNMRAILIDWL
VQVSLKFRLLQETMYMTVGIIDRFLQDHPVPKKQLQLVGVTAMFLASKYEEMYPPEISDF
AYVTDRAYTTAQIRDMEMTILRQLKFQLGRPLPLQFLRRASKIYEVTAEQHTLAKYLLEL
TMVDYEMAHFPPSLLASAAFALTLQILDAGEWDVTLQHYMDYTAESLIPVMAHIAKNVVK
VNDSLTKHMAIKSKYSTSKQMRIATISQLKSSVVKDFAKRLTQ
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggctctccgtgttaccagaaatcgtttggcctccaccaggaccgacctccccgggaag
tcgtgctcggtgaccgggcccacgctcaagcctcgggcggctctcggagaaatcgggaac
gtcgcagtgaaggaggtgcagaggaagaacatcaagaccgaagcagcaaagaagactaaa
gtgaccaaagttgagaaaaccgtagcagtggtggaaccaccaaaagcaccaaagaatgtt
gttcctgttaaacctgagcccgaggtgcaggttctccctgaaccagtatcccccactcca
atggagacttctggctgtgagcctcgtgacctctgccaggctttttcagacgtcatgctg
gaaactgcagtcagggacgtggacgcagacgactacgacaacccaatgctctgcagcgaa
tatgtgaaggacatttacaagtacctgcggcagcttgaggttgagcagaacgtcagactc
cattacctgcagggccacgaggtcaccggtaacatgcgagccattctcatcgactggctg
gtgcaggtcagcctgaagttccgtctgctgcaggaaaccatgtacatgactgtgggaatc
attgatcgctttcttcaggaccacccagtccccaagaagcagctgcagctggtcggtgtc
accgccatgttcctcgcttccaaatacgaggagatgtatcccccggagatctcagacttt
gcctacgtgacggaccgggcctacaccactgcccagatcagagacatggagatgaccatc
ctgcggcagctcaagttccagctcggccgccctctgcccctgcagttcctcaggagggcc
tcaaagatttatgaggtgactgctgagcagcacaccctggctaagtacctcctggagctc
accatggtggactatgagatggctcacttcccaccttccctgttggccagtgctgccttc
gctctcaccctccagatcctggatgctggtgaatgggatgtgacgctgcagcactacatg
gactacacagcagagagtttgattcctgtgatggcgcacattgccaagaacgttgtgaag
gtgaacgacagcctgacaaagcacatggccatcaagagcaaatactccacttcaaagcag
atgaggatcgccaccatctcgcagctcaagtcttctgtggtgaaggatttcgctaagcgg
ctcacacagtga

KEGG   Paralichthys olivaceus (Japanese flounder): 109647535
Entry
109647535         CDS       T06037                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B2-like
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04114  Oocyte meiosis
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109647535
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109647535
   04114 Oocyte meiosis
    109647535
   04115 p53 signaling pathway
    109647535
   04218 Cellular senescence
    109647535
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109647535
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pov03032]
    109647535
   03036 Chromosome and associated proteins [BR:pov03036]
    109647535
DNA replication proteins [BR:pov03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109647535
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109647535
SSDB
Motif
Pfam: Cyclin_N Cyclin_C VbhA
Other DBs
NCBI-GeneID: 109647535
NCBI-ProteinID: XP_019968903
LinkDB
Position
Unknown
AA seq 393 aa
MSSVELRAALSAADNPLKMGKPAAAGPRRRGALGEITNFPGENVATKRVGAARASSKPSC
GLKAKPAVRTVPPAVQVPAAAHPVPSVPEEPADVSMKEEQELCRAFSEQLLSVQDVDEQD
ADQPQLCSEYVKDIYKYLHVLEVEQAVRANYMQGYEITERMRALLIDWLVQVHSRFQLLQ
ETLYLTVAILDRFLQVQPVSRRKLQLVGVTSMLVACKYEEMYAPEVGDFAYITDNAFTKS
QILEMEQLVLRRLNFELGRPLPLHFLRRASKVAKADVEGHTLAKYLMELTLLDYDMVHYR
PSEVAAASLCLSQLLLEGLSWSPSQQHYSTYDEAHLKPVMQHIAKNVVTVNEGKTKFQAV
KTKYSSSKLMKISLIPQLKSSTVKNMAASLLSP
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgtcgtcagtggagctccgcgctgcgctgtccgccgcagacaacccgctgaagatgggt
aaacccgcggcggcggggccccggaggagaggggccctcggagagatcaccaacttcccc
ggagaaaacgtcgccacgaagagggtcggagcagccagagcatcatccaaaccctcttgt
ggcctgaaagccaaacccgcggtccggacggttcctccagcggttcaggtcccagcagct
gcacatcctgtcccctcagttccagaggagccggccgacgtgtccatgaaggaggagcag
gaactctgccgagctttctccgagcagctgctcagcgtgcaggacgtggacgagcaggac
gcggaccagccgcagctctgctcagagtacgtcaaagatatctataaatatctgcacgtc
ctggaggtggagcaggctgtccgagcgaactacatgcagggttatgaaatcactgaacgc
atgcgagctcttctcatcgactggctggtccaggttcactccaggttccagctgctgcag
gagactctgtatctcactgtcgccatcctggatcgtttcctgcaggtccagccggtctct
cgtaggaagctgcagcttgttggcgtgacctccatgctggtggcctgtaaatacgaggag
atgtacgctccggaggtcggcgactttgcgtacatcacagataacgcttttacaaagtct
cagattctggagatggagcagctggttctgaggcgcctcaactttgagctgggacgtcct
ctcccgctgcacttcctcagacgggcgtcaaaggtggcgaaggccgatgtggagggacac
actctggccaagtatctgatggagctcaccctccttgactacgacatggtccactatcgt
ccctctgaggtcgctgctgcgtccctgtgtctgtctcagctgctgctcgaggggctgtcg
tggtctccatcacagcagcactactccacttacgacgaggcccacctcaagcccgtcatg
cagcacatcgccaaaaacgtagtgactgtaaacgaaggcaaaactaaattccaggccgtg
aagaccaagtactcgagcagcaaactgatgaagatcagcctcatccctcagctgaagtca
tcgaccgtcaagaacatggcggcttctctgctcagcccctga

DBGET integrated database retrieval system