KEGG   Paralichthys olivaceus (Japanese flounder): 109634588
Entry
109634588         CDS       T06037                                 

Gene name
atm
Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov03440  Homologous recombination
pov04068  FoxO signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pov00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    109634588 (atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109634588 (atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109634588 (atm)
   04210 Apoptosis
    109634588 (atm)
   04115 p53 signaling pathway
    109634588 (atm)
   04218 Cellular senescence
    109634588 (atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109634588 (atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pov03032]
    109634588 (atm)
   03400 DNA repair and recombination proteins [BR:pov03400]
    109634588 (atm)
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109634588 (atm)
Protein kinases [BR:pov01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   109634588 (atm)
DNA replication proteins [BR:pov03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109634588 (atm)
DNA repair and recombination proteins [BR:pov03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109634588 (atm)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC DUF3349
Other DBs
NCBI-GeneID: 109634588
NCBI-ProteinID: XP_019950752
LinkDB
Position
Unknown
AA seq 3084 aa
MSLALHDLLVCCRGLENDKATERKKEAERFRRLLRSPEVVQELDRTSGTKTKSSKQLTWD
AVFRFLQRYVQKETESMQSSKSVTATALTTRKKKMAELCSLIKYFIRYANKRGTRLKCSE
LLKHVMEVVQGSYSCSAYGEDYSSLLVKDILSVRKYWCDITPQQWHSLLELYCGLFNSSS
KSINRVLVNRVIHMVVQGCCTQTDGCNNTLFSFFSKALLNARQEKHLAVLEHLVSALNVF
LRYSAMNCRMRVCHLGEELLPSILYIWADMRPSPALKEEIVEFFNLQICVHHPKGAKTQD
TGAHAEDWTRWRSQLYNLYDALVREISHIGSRGKYVSGGRHIAVKNNVIELTADICHQLF
SNNNDSHILEVTQASLRATQLGSPTPGAASKRRRIELGWEVLRDHLQPQHSDFDVIPWLQ
ITAVLTSKYPSMVPCQEMVPLLSVLYQLLAEQRRGERGLYVLRCLREVARCQTRYPERAQ
VHRADLGRLWGRVWALALRGVSSPQTEALSLDLLASIVYGELINMDREFWKLFSASACKL
SQSAAICLCQALLKCPVPKVLTLRSSWEYVGITEGSGSPNLKETLIAWLLMSDQSDEMED
SSRPHPIICRDFPYNLIADILISLTLKDTRAGLNFLLGAEGAESAFIQEQSSIAAKDNLE
EIKRLYLQFSFNVLPSEVRVTKESLRTSSAHGQFTAVPSLRNKLEQSLLCVADTLLNCYS
PDSLSTPPECLVRCVILLTGVLAAYVSTGVLTEENACHSQLLNRAKTVTQDFTGFVSSVK
VKMTEEGTMTALRSVMKLCTQSASRKNTDKVCSISSSLFILTLPASLLSELAEICKLLLS
SVSKRVNVLDEDDHMDDDLEMTRTQQGDNIDLFEDGEESHSSTDGTHRQKGDSTDASCGP
GAKSLLAEDHLAQQDMALLAILEFLCECGSVQHVHGLLFKPQEVRRRLLLLLEQIDFSKP
LHLNMYLVLLKNLPAEDSLSPEEFDLLLRPLADLCSLYRQDQEICAAVLLGLLPSIRSLG
RTHHMPEEMRHVQGSLLQVLSGFCFLSQTGKCIATVRAALVQCLVALLEADPSCKWAVLT
IREEERPVSVILPSHLADTHHQVRMLVAMSVERLFLDMRSGHPDERKMLPLKHQQAAFEN
IYLKAQEGMRLPRCSSSEDQKDEAFNRKTTLLKSLSVVLCCSSVCEKQCLFALFQSYKEN
NIEEQLIKKMLCSVSRALGYRSVKTFVTSHLYYLVAEWLAQRQSDDRYTLGSFPYALLDH
DAIKDFYNSTYQVLIPHLVFLDDFEQVRSIGRYLEKDWKELLADCFPKIMVNILPYFVMS
GQESQIAKQRETAHRVYNLLKDADCLGKQQIDSLIHTNLPDIVVELLMTLYEGGGTEGDR
GELKCFVGELDPVPNPPYFSSYVIKATLDYLSKCHSSNHKSLVAILSKTPISIQRILLAV
CERAAETTNGYERHRILLMYHLFVNLLLKEVKDGLGGAWAFVLRDIIYTLIHQINSRPVQ
GNEVSARSLSLCCDLLTSVCQAALQFCDDALDCHLQAIVGSLTAQVISRPTISQQVLSLL
QFLVIENQQKLKGAISRLQPFPDLPEFRELRTVQHRLKYNTGTFTLRQEITHFLSVTSCD
SLPLTRLEGLKELTRQLHDKKEQIRDLLKECHSDPSDSVLVKLVLSLLQLCKLAANQSGG
ADILEAAGSCLGELGPVDFSTIALLHGRDPLFEKAMSLFTSTESQCLYIILNCMNDSLTQ
QRIEVKQAAAQCVKNILTTQSGVDFWEQHKDNRDSMLAYLNPFRKAKSKVVAVSAVASSE
AREKLESQECWIPQAGGHKAWLKALCTALLDSGGVKSEALLLSRPLCLVKVDCCQRLLPL
IIHSILLDDSDGSWRRLLSSHIQDFFSFCSRSAQAASRSATPLNSDYESDTASQGLYDKT
SLRTMLAVIDYLRHQQRPLESESNSCGTVCNSNFWLELNYLEVAKAAQSCAAHFTALLYT
EIYVDKVKACMEETRRTKSRATYKLTFEEHSQNVTISSLTEKSMEDTNISLQELLIEVYR
SIGEPDSLYGCGGETNTSPLTRIRTYEHEAMWGKALTSYDLHSSLPETTRQVGIVEGLQN
FGLSSILATYMRGLESEGVEWGAELRELRFQAAWRNTQWDCELSVRSEKSTPGFHESVFS
SLQALRDKDFSLFDETLKQARGTEVEELCRGSLEAVSSLYPALRNLQSIRELESVKQLFS
RPFSDVTLRDVCSQWRQHSQLLADSDFALVEPILSVRSVAQHTLMSRTGDTESTEYLSSV
LTDHLMELCQLARKAGNTQRAERAVFQMKPHGGGGSWMSSPVLSWQLEEAQVFWAKGEQG
LALGLLRQMIHNLEGKVDLNPALAPVYTQCLRLCGNWLAETCLESPGIILEKYLEMAVEV
IKGESGVQDSRLQSQRTEAFLSLARFSDAQYQSIDKYMNSSEFENKQALLEKAKQEVDLM
KERKVTSNRYTTKVQRELELDVKALSSLKADRQRFLCKAVENYIQCLKQGEEHDTWVFRL
ASLWLENDDVRAVNDMMKTGVKQIPSYKFLPLMYQLAARMGTKVATSITEDTGFHDVLID
LICRASLEHPHHTLFIIFALVNANKDENFCRSRQSRSTQRQTPPFDLERSEVARKIINAI
RKKKGQMIQGLEHLCDAYITLAYMDASKHKTEKKAIPIPADQPIMQIKDLDEVVIPTMEI
KVDQTGCYDNLVTIRSFVPHYRLAGGVNLPKIIDCVGSDGKSRRQLVKGKDDLRQDAVMQ
QVFSMCSMLLQRNSDTRKRKLNIRRYKVVPFSQCSGVLEWCSGTVPIGEFLADPYEGAHK
RFRPRDWTNLTCRKKMMEACDDKLQAYTEVCKNFRPVFRYFCMERFLDPAVWMEKRLAYT
RSVATSSIVGYIVGLGDRHIQNILIDEQTAELVHIDLGVAFEQGKILPTPETVPFRLSRD
IVDGMGITGVEGVFRRCCEKTMEVMRSSQEALLTIVQVLLYDPLFDWTMNPLKAFYLQHD
EQQELNATLSSTMGGDDIYNHRKSSDSQSFNKVAERVLLRLQEKLKGVEEGTVLSVGGQV
NLLIQQAMDPKNLSRLYPGWQAWV
NT seq 9255 nt   +upstreamnt  +downstreamnt
atgagtctggctcttcatgatctcctggtctgctgcagggggctggagaatgataaagcc
acagagaggaagaaagaagccgaacgcttcagacggctcctccgatctccagaggtcgtg
caggagttggaccgcacctcaggaactaaaactaaatcgtccaagcagctcacatgggat
gctgttttcagatttctgcagcgctatgtccagaaggagacagagagcatgcagtcaagt
aaatctgtcacagcgacagcactcaccacacggaagaagaagatggcggaactgtgcagt
ttgatcaaatacttcattcgctatgcaaacaaacgcgggactcgtctaaagtgcagtgaa
ctgctgaaacatgtgatggaggtggtgcagggctcttacagctgctctgcttacggagaa
gattatagcagcctcctcgtgaaggacatcctctctgtccgcaagtactggtgtgacatc
accccacagcagtggcacagtcttttggagttgtactgtggcttgttcaactcttcttcc
aaatccataaatcgtgttttagtgaacagagtcatccacatggtggtgcagggctgctgc
acgcagactgatggatgtaacaataccctgttcagcttcttctccaaagcactgcttaac
gccaggcaggagaaacacttggccgttttggagcaccttgtctcggctctcaacgtattc
ttgaggtactcagctatgaactgcagaatgagggtgtgccacctgggagaggagcttctg
ccatccatactgtacatctgggcagatatgaggcccagtcctgctcttaaagaggagatc
gtggagttcttcaatctgcagatttgtgttcatcaccccaaaggagccaagacacaggac
acaggtgcacatgctgaggactggactcggtggaggagtcagctctacaatttgtatgat
gctttggtcagagaaatcagtcatatcggcagcagagggaagtacgtcagtggggggaga
cacattgcagtgaaaaacaatgtcattgagctcacagctgatatctgtcatcagttgttc
agcaataacaatgactcccacatcttggaggtgacccaggcctccctcagagccacacag
ttgggaagtcccacccctggagcagccagcaagcgccgccgtatcgagcttggttgggag
gtcctccgagaccatcttcagcctcagcacagtgacttcgatgtcataccatggctgcag
atcactgcggtgctcacttccaagtatccgtccatggtgccctgccaggagatggtgcct
ctgctctctgtgttgtaccagctcctggcagagcagaggagaggagagagggggctgtac
gtgctgcgctgtctgagggaggtggcccggtgccagacccgctatcctgagagggcccag
gtccacagggcagatttgggaaggctgtggggtcgggtatgggcccttgcactacggggg
gtcagctcgcctcagacagaggccctcagcctggacctgctggcctccatcgtctacgga
gaactaattaatatggacagagagttctggaagcttttctctgcatcagcgtgcaaacta
tcacagagtgccgccatctgtctgtgtcaagctctactgaagtgtccagtccctaaggtt
ctcaccctgaggtcaagctgggaatacgtagggatcacagaaggatctggttctccaaac
ctgaaggagaccctcattgcatggctgctgatgagtgaccagagtgatgagatggaagat
agctccagacctcaccccatcatttgcagagactttccctacaatttaatagccgacatc
ctgatctccctgaccttgaaagacaccagagctggcctgaactttctgctgggtgctgaa
ggagctgagagtgcctttattcaagagcaatcctcaattgctgccaaagacaacctggaa
gagatcaagaggctgtacttacagttcagcttcaacgtgctgccctcagaggtcagagtg
accaaagagtccctgaggacttcatcagctcacggccagttcactgctgtccccagtctc
agaaacaagctggagcagtccctgctttgtgtggctgacacactacttaactgctactct
cctgattctctgtccacacctccagagtgtctggtgcgctgcgtcattctgctgactggt
gttttagcagcttacgtctccactggggttctgactgaagagaatgcctgtcactcacag
ctcctcaacagggcaaagactgtgactcaggacttcactggatttgtttcaagtgtgaaa
gtaaagatgacagaggaggggaccatgaccgctcttaggtctgtcatgaagctgtgcaca
cagtcagccagcagaaaaaacacggataaagtttgttccatctcctccagcctgtttatt
ttgacactgccggccagtctcctcagtgaattagcagagatctgcaaactgttgctaagc
agtgtttctaagagagtcaatgttttggatgaagacgatcacatggatgatgacttggag
atgaccaggactcaacaaggggacaatattgacctgtttgaggatggtgaggagtctcac
agcagcaccgacgggacccacagacagaagggagacagcactgacgcttcttgtggacca
ggagccaaaagcttgttagcagaggatcatctggcccagcaggacatggctctcctcgcc
attttggagttcctgtgtgagtgcggctctgtccagcatgtccacggcctgcttttcaaa
ccccaggaggtgcggcgcaggctgctgctgctgctggaacagattgacttcagcaaaccg
ctgcacctcaacatgtatcttgttctgctcaagaatcttcctgctgaggactcgctttct
ccagaggaatttgatttgctgctgcgtccgctggcagatttgtgtagcctgtaccgtcag
gaccaagagatctgtgctgctgtgctgcttggtttgttaccctccatcaggagcctgggg
agaacccaccacatgccagaggaaatgagacatgttcagggatccctgctccaagtgctg
tccggattctgtttcctgagccaaacagggaaatgcatcgcaactgttcgagctgcttta
gtgcagtgtctggttgctttgctggaggctgacccctcttgtaagtgggcagtcctaact
attagggaggaggagcgtccagtgtccgtaatcctcccatctcacctggcagatacccat
caccaagtccgcatgctggtagccatgtcagtggagaggttgtttctggacatgagatca
gggcatcctgatgaaaggaagatgctgccactcaaacaccagcaggctgcttttgaaaat
atttacctgaaggctcaggagggaatgaggcttccaagatgcagctcttcagaggaccag
aaggatgaggcgttcaaccggaagaccacactgttgaagagtttgtctgtggtgctgtgc
tgtagttcagtgtgtgaaaaacagtgtctgtttgccctcttccagtcctacaaggagaac
aacatcgaggagcagcttattaaaaagatgttgtgcagtgtatccagagcactgggatac
aggagtgtgaaaacatttgtcacttctcacttgtattacttggtggcggagtggctcgca
caaaggcagtctgacgatcgatacactctcggctctttcccctacgcgctccttgaccat
gacgccatcaaagatttctataactctacttatcaggtattgatcccccacctggtcttc
ctcgatgactttgagcaggtgaggtctatcggtaggtatctggagaaggactggaaggag
ctgttggccgactgcttccccaagatcatggtcaacatcctgccgtacttcgttatgtct
ggccaggagtcgcagattgcaaagcagagagagacagcccacagagtttacaacctgctc
aaagatgccgactgtctgggcaaacagcaaatcgacagccttatccacactaacctgccg
gacatagtggtggagttgctgatgactttgtatgaaggaggtggaactgaaggagacaga
ggagagctgaaatgctttgtaggggaactggaccctgtaccaaacccaccatacttcagc
tcttatgtcatcaaagctactctggactacctgagcaagtgccacagttccaaccacaag
tcactggtagccattctgtcaaaaactccgatttctattcaaaggatcctgctggcggtg
tgtgaaagagcagcagagacgaccaacggctatgaacgccatcgtatcctcctcatgtat
cacctgtttgtcaacctgctgctcaaagaggtgaaagacggtctgggaggagcctgggcc
tttgtgctcagagacataatctacacactcatacaccagatcaacagcagaccagttcag
ggcaatgaggtctctgcccgaagcctctctctgtgctgcgacctgttgacttctgtgtgt
caggcagctctgcagttctgtgatgacgctctagactgccacctacaggccattgttggg
tctctcacggctcaggtcatcagccggcccaccatctcacagcaggtgcttagtctgttg
cagtttctcgtgattgagaatcaacagaagttaaaaggagccatcagcaggttgcagcct
tttcccgacctgcctgaattcagagaactgcggactgtacagcacaggctcaaatataat
actgggacctttacgttgcgacaggagatcacccacttcctgtcagtgacgtcctgtgac
tccttacctctgaccagactggagggactgaaggagctgaccagacagctgcatgacaag
aaggaacaaattagagacctgctcaaagagtgccactctgaccccagtgacagcgtgctg
gtgaagctggttcttagtctgctgcagctctgtaagctagcagccaaccaatcgggcgga
gccgacatacttgaggcagcaggcagctgtcttggagaactgggtccagtggatttctcc
actatcgccctgctccatggcagagaccccctctttgaaaaggcaatgtctctcttcacc
tcaacagagtctcagtgtctatacatcattctcaactgcatgaatgactcgctcactcag
cagcgtattgaggtgaagcaggcagctgctcagtgtgtgaagaacatcctcacaactcag
tctggagttgacttctgggagcagcacaaagacaacagagactccatgttggcctacctt
aatccttttagaaaggccaagagcaaggtggttgctgtgagtgctgtggcgagttcggag
gctcgggagaagctggagagtcaggagtgttggatccctcaggctggtggccacaaggcc
tggctgaaggctctctgcaccgccctgctggacagtggaggagtgaagagtgaagcactg
ctcctgtcgagaccactgtgtctggtgaaagtagactgctgccagaggctgctgccccta
atcatccactccatccttctggacgactctgatggctcatggaggaggttgctctcatcc
cacattcaggacttttttagtttctgttccagaagtgctcaggctgccagtcgctctgcc
acacctctcaactctgactatgagtctgacacggccagccagggtttgtatgataagacc
tctctgcgcaccatgctggcggtcattgactatttgagacaccagcagagaccactggag
tctgagagtaattcctgcggcaccgtgtgtaactcaaacttctggctggagctgaactac
ctagaggtggccaaagctgctcagtcgtgtgcagctcacttcaccgctctgttgtacacg
gagatttacgtcgacaaggtcaaagcttgcatggaggaaacccgcagaaccaagtccaga
gcgacatacaagctcacttttgaagagcacagccagaacgtcaccatctccagcctgaca
gagaaaagtatggaggacaccaacatcagtctgcaggagcttcttattgaggtgtatcga
agcatcggagaacctgacagtctgtatggctgcggaggggaaactaataccagtccactg
accaggattcgaacctatgagcatgaggctatgtgggggaaggccctgacctcctacgat
cttcactcctctttgcctgagaccacgcgacaagtgggaatcgtggagggcctgcagaac
tttggtctgagcagcatcctggccacttacatgaggggtttggagagcgaaggggtggaa
tggggggctgagctaagagagcttcggttccaggccgcatggaggaacacgcagtgggac
tgtgagctgtctgtgaggagtgagaaatcaacacctggcttccacgaatcagtgttttct
tccctacaagcgctgagggacaaagacttctccttatttgatgaaacgctgaaacaggcc
aggggcacagaggtggaggagctgtgcagaggcagtctggaggccgtttcttctctgtac
ccggcgctcaggaaccttcagagcatcagggagctggagagcgttaaacagctcttctcg
agacccttctcggatgtgactctgagggacgtttgcagccaatggcggcagcactcccag
ctcctcgctgacagtgactttgcgttggttgagcccattctgtccgtccgctctgtggcc
cagcacaccctgatgtccaggacgggagacacagagagcacagagtacctcagctctgtg
ctcactgaccacctcatggagctctgccagctggctcgcaaggctgggaatacacagagg
gcagagcgggcagtcttccagatgaaaccgcacggtggcggagggtcctggatgtcatca
cctgtgttgtcatggcaactggaggaggcccaggtgttttgggcaaagggagagcagggt
ctggctctaggcctgctgagacagatgatacacaacctggagggaaaggtggatctaaat
cctgctctggctccagtttacactcagtgcctcaggctgtgtggtaactggctcgctgag
acctgtttggaaagtcccggaatcatactggagaagtacctggagatggcagtggaggtg
atcaagggggagtcgggggtgcaggactccaggctgcagagtcagcggactgaggccttc
ttgtctctggcccgattctctgatgctcagtaccagagcatcgacaaatacatgaactcc
tctgagtttgagaacaagcaggcgctgctggagaaggccaaacaggaagtggatttgatg
aaggagcggaaagtgacctccaacaggtacactacaaaggtgcagagggagttggagttg
gatgtgaaggccctgtccagcctgaaggcagacagacagcgcttcctgtgtaaggcggtt
gagaattacattcagtgtctgaagcagggggaggagcatgacacctgggtgttccgtctg
gcttcactctggttggagaatgatgacgttagggctgtaaatgacatgatgaagacaggg
gtgaagcagatcccctcctacaagtttctgcctctcatgtatcagctggctgcacgcatg
ggaaccaaggtggcaaccagcatcactgaggacacgggcttccatgatgtcctcattgat
ctgatctgccgagcttcacttgagcatcctcaccacacactcttcatcatcttcgctctg
gtgaatgccaacaaagatgagaacttctgcaggtcccggcagtcgagaagtactcaaagg
cagacaccacctttcgatctagagcgttcagaagtggcccgaaagattatcaacgccatc
aggaaaaagaaaggccagatgatccaagggctcgagcatttgtgtgatgcctacatcact
ctggcctacatggacgctagcaagcacaagactgagaagaaggcgattcccatccctgct
gatcagcccatcatgcaaatcaaagacctggatgaggttgtcatccccacaatggagatt
aaggtggatcaaactggttgctacgacaacctggtgacgatcaggtccttcgtacctcac
tatcgcttggccggaggagtcaacctgcccaaaatcattgactgtgtcggctctgatggc
aagagccggagacaactggtcaagggcaaggacgacctgcggcaggatgcggtgatgcag
caggtattcagcatgtgctccatgctgctgcagcgcaactcagacactcgtaagaggaag
ctgaacatcagacgatacaaggtggtgccgttctcgcagtgcagtggcgtgttagagtgg
tgctctggcaccgttcccatcggggagtttctagcggatccttacgaaggagcccacaaa
cgcttccgacctcgagactggaccaacctaacctgccgcaagaagatgatggaggcatgt
gatgacaagctccaggcctacactgaggtgtgcaagaacttcaggcctgtcttcaggtat
ttctgcatggaacgcttcctggatccagcggtgtggatggagaaacgtctggcctacacc
cgcagcgtggcgacctcctctatagttgggtacatcgtgggtctgggcgacagacacatc
cagaacattctgattgacgagcagaccgctgaactggttcacattgatttaggtgtggcc
tttgagcaggggaagatccttcccacaccagagactgtccccttcagactctccagggac
atcgtggatgggatgggcatcactggagtggagggagttttcaggagatgttgtgagaag
accatggaggtgatgaggagctctcaagaagctctgctgaccattgtacaggtgctgctg
tacgaccctttgtttgactggaccatgaaccctctgaaggcgttctacctgcagcacgac
gagcagcaggagctcaacgccacgctgagctccaccatgggcggagacgacatatacaac
caccgtaaatccagtgacagccagagcttcaacaaggtggctgagcgcgtgctgctgcgg
ctgcaggagaagctgaagggcgtggaggagggcacggtgctcagcgtcggggggcaggtc
aacctgctcatccaacaggccatggatcccaaaaacctcagcagactgtatcctggatgg
caagcctgggtgtag

DBGET integrated database retrieval system