KEGG   Paralichthys olivaceus (Japanese flounder): 109634811Help
Entry
109634811         CDS       T06037                                 

Gene name
pten
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00562  Inositol phosphate metabolism
pov01100  Metabolic pathways
pov04068  FoxO signaling pathway
pov04070  Phosphatidylinositol signaling system
pov04115  p53 signaling pathway
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04218  Cellular senescence
pov04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109634811 (pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109634811 (pten)
   04070 Phosphatidylinositol signaling system
    109634811 (pten)
   04150 mTOR signaling pathway
    109634811 (pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109634811 (pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    109634811 (pten)
   04218 Cellular senescence
    109634811 (pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109634811 (pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pov01009]
    109634811 (pten)
Enzymes [BR:pov01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109634811 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     109634811 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     109634811 (pten)
Protein phosphatases and associated proteins [BR:pov01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    109634811 (pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 109634811
NCBI-ProteinID: XP_019951069
LinkDB All DBs
Position
Unknown
AA seq 445 aa AA seqDB search
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPADRLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNQLEYKPVALLFHKMVFETLPMFSGGTCRDSTVKNRSEPTPQGFKKGNWHWDPQFVV
YQLKVKIHTSHPAHTRREDKHMFFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPEESGDKMENGAVNNAESQQGGPGQGQPQPQLQMQTQRAESRDSCRDSDRDYLIL
TLTKNDLDKANKDKANRYFSPNFKVKLYFTKAVEEPSNSEASTSTSVTPDVSDNEPDHYR
YSDTTDSDPENEPFDEEQHTQITKV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgattataaaagaaatggtcagccggaacaaaaggagatatcaagaggatggg
ttcgacctggacttaacatatatctacccaaacatcattgctatgggctttccagcagac
agactcgagggcgtgtacagaaacaatatagacgatgtagtacggtttttggattcaaag
cataaaaaccattacaaaatctacaacctctgtgcagaaagacactacgatgctgccaaa
tttaactgcagagttgcacagtaccccttcgaagaccacaaccctcctcagctggagcta
attaagccgttttgtgaagacctggaccagtggctcagtgaggatgacaatcacgtggcg
gccatccactgtaaggccgggaagggccgaacaggagtcatgatctgcgcctatctcctc
catcgcggcaaattcctggaggcccaagaagcgcttgacttttacggggaagtcaggaca
agggacaagaagggagtaacgatcccgagccagcgccgctacgtctactactacagctac
ctactgaagaaccagctagagtacaagccggtggcgctcctcttccacaaaatggtgttt
gagactctccccatgttcagcgggggcacctgcagggacagtaccgttaaaaacaggagc
gagccgacccctcagggcttcaagaaagggaattggcattgggatccccagtttgtggtg
taccagctgaaagtgaagattcacacgtcgcaccccgctcacacgcggcgcgaggacaag
cacatgtttttcgaattcccccagccgctgccggtttgtggagacatcaaagtggagttc
ttccataaacaaaataagatgatgaagaaggacaaaatgtttcacttctgggtgaacacc
ttcttcatccctggaccagaggaaagcggggacaagatggaaaacggggcagtgaacaat
gcggagagccagcaggggggaccggggcaggggcagccacaaccacagctacagatgcag
acgcagcgcgctgagagcagggacagctgcagggacagcgacagggactacctcatcctg
acgctcactaagaacgacttggacaaggccaacaaagacaaagctaaccgctacttctcg
ccaaacttcaaggtgaagttgtattttacgaaagccgtggaggagccttcgaattctgag
gcaagcacttcaacatccgtcaccccggacgttagcgacaatgagccagaccattatcga
tactctgacaccactgactctgatccggaaaatgaaccttttgatgaagagcagcacacg
caaatcacaaaagtgtga

DBGET integrated database retrieval system