KEGG   Paralichthys olivaceus (Japanese flounder): 109634811
Entry
109634811         CDS       T06037                                 

Gene name
pten
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00562  Inositol phosphate metabolism
pov01100  Metabolic pathways
pov04068  FoxO signaling pathway
pov04070  Phosphatidylinositol signaling system
pov04115  p53 signaling pathway
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04218  Cellular senescence
pov04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109634811 (pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109634811 (pten)
   04070 Phosphatidylinositol signaling system
    109634811 (pten)
   04150 mTOR signaling pathway
    109634811 (pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109634811 (pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    109634811 (pten)
   04218 Cellular senescence
    109634811 (pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109634811 (pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pov01009]
    109634811 (pten)
Enzymes [BR:pov01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109634811 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     109634811 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     109634811 (pten)
Protein phosphatases and associated proteins [BR:pov01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    109634811 (pten)
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 109634811
NCBI-ProteinID: XP_019951069
LinkDB
Position
Unknown
AA seq 445 aa
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPADRLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNQLEYKPVALLFHKMVFETLPMFSGGTCRDSTVKNRSEPTPQGFKKGNWHWDPQFVV
YQLKVKIHTSHPAHTRREDKHMFFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPEESGDKMENGAVNNAESQQGGPGQGQPQPQLQMQTQRAESRDSCRDSDRDYLIL
TLTKNDLDKANKDKANRYFSPNFKVKLYFTKAVEEPSNSEASTSTSVTPDVSDNEPDHYR
YSDTTDSDPENEPFDEEQHTQITKV
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggctgcgattataaaagaaatggtcagccggaacaaaaggagatatcaagaggatggg
ttcgacctggacttaacatatatctacccaaacatcattgctatgggctttccagcagac
agactcgagggcgtgtacagaaacaatatagacgatgtagtacggtttttggattcaaag
cataaaaaccattacaaaatctacaacctctgtgcagaaagacactacgatgctgccaaa
tttaactgcagagttgcacagtaccccttcgaagaccacaaccctcctcagctggagcta
attaagccgttttgtgaagacctggaccagtggctcagtgaggatgacaatcacgtggcg
gccatccactgtaaggccgggaagggccgaacaggagtcatgatctgcgcctatctcctc
catcgcggcaaattcctggaggcccaagaagcgcttgacttttacggggaagtcaggaca
agggacaagaagggagtaacgatcccgagccagcgccgctacgtctactactacagctac
ctactgaagaaccagctagagtacaagccggtggcgctcctcttccacaaaatggtgttt
gagactctccccatgttcagcgggggcacctgcagggacagtaccgttaaaaacaggagc
gagccgacccctcagggcttcaagaaagggaattggcattgggatccccagtttgtggtg
taccagctgaaagtgaagattcacacgtcgcaccccgctcacacgcggcgcgaggacaag
cacatgtttttcgaattcccccagccgctgccggtttgtggagacatcaaagtggagttc
ttccataaacaaaataagatgatgaagaaggacaaaatgtttcacttctgggtgaacacc
ttcttcatccctggaccagaggaaagcggggacaagatggaaaacggggcagtgaacaat
gcggagagccagcaggggggaccggggcaggggcagccacaaccacagctacagatgcag
acgcagcgcgctgagagcagggacagctgcagggacagcgacagggactacctcatcctg
acgctcactaagaacgacttggacaaggccaacaaagacaaagctaaccgctacttctcg
ccaaacttcaaggtgaagttgtattttacgaaagccgtggaggagccttcgaattctgag
gcaagcacttcaacatccgtcaccccggacgttagcgacaatgagccagaccattatcga
tactctgacaccactgactctgatccggaaaatgaaccttttgatgaagagcagcacacg
caaatcacaaaagtgtga

KEGG   Paralichthys olivaceus (Japanese flounder): 109644901
Entry
109644901         CDS       T06037                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov00562  Inositol phosphate metabolism
pov01100  Metabolic pathways
pov04068  FoxO signaling pathway
pov04070  Phosphatidylinositol signaling system
pov04115  p53 signaling pathway
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04218  Cellular senescence
pov04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pov00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109644901
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109644901
   04070 Phosphatidylinositol signaling system
    109644901
   04150 mTOR signaling pathway
    109644901
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109644901
  09143 Cell growth and death
   04115 p53 signaling pathway
    109644901
   04218 Cellular senescence
    109644901
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109644901
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pov01009]
    109644901
Enzymes [BR:pov01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109644901
    3.1.3.48  protein-tyrosine-phosphatase
     109644901
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     109644901
Protein phosphatases and associated proteins [BR:pov01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    109644901
SSDB
Motif
Pfam: PTEN_C2
Other DBs
NCBI-GeneID: 109644901
NCBI-ProteinID: XP_019965930
LinkDB
Position
Unknown
AA seq 214 aa
MLFETIPMFTAGTCNPQFVVYQLKVKIHTSNPAHTRREDKVMLFEFPQPLPVCGDIKVDF
FHKQNKMMKKEKMFHFWVNTFFIPGPEENTDKLENGSTGMLRELADRTHQNLAMTMASVT
KGGETNDREYLILTLIKNDLDKANKDKANRNFSPNFKVKLFFTKTVEEGANCDTSSTSTS
VTPDVSDNEPDHYRYSDTTDSDPENEPFEEDHNN
NT seq 645 nt   +upstreamnt  +downstreamnt
atgctgtttgaaacgatcccaatgttcacagctggaacctgcaatcctcagtttgtcgtt
taccagctgaaggtgaagattcacacctctaaccccgcccacactcggcgggaagacaaa
gtgatgctgtttgagttcccgcagccacttcctgtctgtggagacatcaaggtggacttc
ttccacaagcagaacaagatgatgaagaaggaaaagatgtttcacttctgggtcaacacc
ttcttcatcccggggccggaggagaacacggacaaactggagaacggcagcaccgggatg
ctgcgggaactggccgacagaacgcaccagaacctggcaatgacgatggcgagtgtgaca
aagggaggagaaaccaacgacagggaatatctgatcctcacgctgatcaagaacgacctg
gacaaggccaacaaagacaaggccaacaggaacttctcccccaacttcaaggtgaagctg
ttctttaccaagacggtggaggaaggagctaactgtgacacgagcagcacgtcgacctca
gtgaccccggacgtcagcgacaacgaacccgatcactaccgctactctgacacaacggac
tctgaccccgagaacgagccgttcgaagaggaccacaacaattag

DBGET integrated database retrieval system