KEGG   Paralichthys olivaceus (Japanese flounder): 109634873
Entry
109634873         CDS       T06037                                 

Gene name
bad
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04012  ErbB signaling pathway
pov04140  Autophagy - animal
pov04210  Apoptosis
pov04370  VEGF signaling pathway
pov04510  Focal adhesion
pov04910  Insulin signaling pathway
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109634873 (bad)
   04370 VEGF signaling pathway
    109634873 (bad)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109634873 (bad)
  09143 Cell growth and death
   04210 Apoptosis
    109634873 (bad)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109634873 (bad)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109634873 (bad)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109634873 (bad)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 109634873
NCBI-ProteinID: XP_019951212
LinkDB
Position
Unknown
AA seq 167 aa
MAANFTISDSESEPSEEIEEAEMSQSSTESEHQVLQRHNLTLPELRIAATGRIRLNSESH
ASTVSRDEELQTRADEEVGTPTDGAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLD
KGAMRKVKSAGTAKQMHHSKSWWSYLFSHQEIEGENSHLENHTHRTE
NT seq 504 nt   +upstreamnt  +downstreamnt
atggctgcaaacttcaccatttcagacagcgagtcggagccgtcggaggagatagaggaa
gcagaaatgagccaatcatcgactgagtcagagcatcaggttcttcagcgccacaacctc
accttacctgagctcagaatagcagcaactggtagaatcaggctgaactcagagtcccac
gcctccactgtctcacgagacgaggagctccaaaccagggcggatgaggaagtcggcacg
cccaccgacggcgctccattccgaggacggtccaagtcggctccccctgcactgtgggcg
gcaaagaagtacggccagaagctccggaggatgagcgacgagtttgacagcctgctagac
aaaggggcaatgaggaaggtgaagagtgccgggacggccaaacagatgcaccactctaaa
agctggtggagctacctcttcagtcaccaggagattgagggagagaacagccaccttgag
aatcacactcaccgcactgagtag

DBGET integrated database retrieval system