KEGG   Paralichthys olivaceus (Japanese flounder): 109634900
Entry
109634900         CDS       T06037                                 

Definition
(RefSeq) cellular tumor antigen p53-like isoform X1
  KO
K04451  tumor protein p53
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04110  Cell cycle
pov04115  p53 signaling pathway
pov04137  Mitophagy - animal
pov04210  Apoptosis
pov04216  Ferroptosis
pov04218  Cellular senescence
pov04310  Wnt signaling pathway
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109634900
   04310 Wnt signaling pathway
    109634900
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109634900
  09143 Cell growth and death
   04110 Cell cycle
    109634900
   04210 Apoptosis
    109634900
   04216 Ferroptosis
    109634900
   04115 p53 signaling pathway
    109634900
   04218 Cellular senescence
    109634900
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109634900
Transcription factors [BR:pov03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    109634900
Chromosome and associated proteins [BR:pov03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109634900
DNA repair and recombination proteins [BR:pov03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109634900
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD DUF4757 AP3D1
Other DBs
NCBI-GeneID: 109634900
NCBI-ProteinID: XP_019951269
LinkDB
Position
Unknown
AA seq 365 aa
MEEQGLENEELTPSLPLSQISFPDLWANVVMPSISSIPGPVDDMDMLLMQDELDLNCLFE
LPPETVTKDGVIPPASTVPVTTDYPGEYGFQLRFQKSGTAKSVTSTFSELLNKLYCQLAK
TSPVEVLVSKEPPQGAFLRATAVYKKTEHVADVVRRCPHHQNEDTAEHRSHLIRLGGSQR
AQYFEDLHTKRQSVTVPYEPPQLGSEMTTILLSFMCNSSCMGGMNRRQILTILTLETPEG
LVLGRRCFEVRVCACPGRDRKTDEESSTKTQSGPKQTKKRKTNPVPHTTTMKKSKSASSA
EEEDKEVFHLPIVGRGRYEMFKKINEGLELLDREKTKNKVSVKQELPVPSTGKRLLQRGE
QSDSD
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggaagagcaaggtttggaaaatgaggagttgaccccgagccttcccctgagtcagata
tccttcccagatctgtgggcgaatgtagtgatgccgtccatctccagcatcccagggcca
gtggatgacatggacatgttgctcatgcaagatgagttagatttgaactgcctgtttgaa
ctgcctccagagacggtaactaaagatggcgttattcccccagcctccaccgtcccggtc
acgaccgactaccctggggaatatggcttccagcttcgcttccagaagtctggcacagcg
aaatctgtcacctccactttttcggagcttctcaacaagctgtattgccagctggctaaa
accagccctgtggaggtgttggtgagcaaggagcctcctcagggtgctttcctcagagcc
acagcggtctacaagaagacggagcatgtggctgatgttgtccgtagatgcccccatcac
cagaatgaggacactgcagagcatcgcagccatctgatcagactggggggcagccagagg
gctcagtatttcgaagatctacacacaaagaggcagagtgtgaccgtcccatacgaaccc
cctcagctgggctcagagatgacgaccatcctgctgagctttatgtgcaacagctcatgc
atgggcggcatgaaccgcagacagatcctcaccatcctgaccctcgagactcccgaggga
ctggtgttgggtcggagatgcttcgaggtgcgtgtctgtgcatgtccaggaagggaccgt
aaaaccgacgaggaaagcagcaccaagacacaaagcggccccaaacagaccaagaagcgt
aagactaacccagttccccacaccactacgatgaagaaatcaaagtctgcctccagcgca
gaggaagaggacaaggaggtctttcatcttcctattgtcggtcggggccgctacgaaatg
tttaaaaaaatcaacgagggtttggagcttctggatcgagagaaaaccaagaacaaagtc
tcagtgaaacaagagctccctgttccctccactggaaagagactcctgcagagaggagag
cagagcgacagtgactga

DBGET integrated database retrieval system