KEGG   Paralichthys olivaceus (Japanese flounder): 109635227
Entry
109635227         CDS       T06037                                 

Gene name
raf1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04012  ErbB signaling pathway
pov04068  FoxO signaling pathway
pov04140  Autophagy - animal
pov04150  mTOR signaling pathway
pov04210  Apoptosis
pov04218  Cellular senescence
pov04270  Vascular smooth muscle contraction
pov04370  VEGF signaling pathway
pov04371  Apelin signaling pathway
pov04510  Focal adhesion
pov04540  Gap junction
pov04625  C-type lectin receptor signaling pathway
pov04810  Regulation of actin cytoskeleton
pov04910  Insulin signaling pathway
pov04912  GnRH signaling pathway
pov04914  Progesterone-mediated oocyte maturation
pov04916  Melanogenesis
pov05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109635227 (raf1)
   04012 ErbB signaling pathway
    109635227 (raf1)
   04370 VEGF signaling pathway
    109635227 (raf1)
   04371 Apelin signaling pathway
    109635227 (raf1)
   04068 FoxO signaling pathway
    109635227 (raf1)
   04150 mTOR signaling pathway
    109635227 (raf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109635227 (raf1)
  09143 Cell growth and death
   04210 Apoptosis
    109635227 (raf1)
   04218 Cellular senescence
    109635227 (raf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109635227 (raf1)
   04540 Gap junction
    109635227 (raf1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109635227 (raf1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109635227 (raf1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109635227 (raf1)
   04912 GnRH signaling pathway
    109635227 (raf1)
   04914 Progesterone-mediated oocyte maturation
    109635227 (raf1)
   04916 Melanogenesis
    109635227 (raf1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109635227 (raf1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109635227 (raf1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109635227 (raf1)
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109635227 (raf1)
Protein kinases [BR:pov01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   109635227 (raf1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 zf-RING_2
Other DBs
NCBI-GeneID: 109635227
NCBI-ProteinID: XP_019951823
LinkDB
Position
Unknown
AA seq 635 aa
MEHLQGAWKTLSNGFGMKDSAFEGPCLSPTMVQGFPCHRRSSDDSKMPDSKTSSTIRVYL
PNQQRTVVNVRPGMTLQNCLIKALKVRGLQPQCCAVFRLHPGQRSKKLRMDWHTDSTSVI
GEELLVEVLDHVPLTTHNFVRKTYLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPT
MCVDWSNIRQLLLCPTPGESGAPSLPPLTSRRMRESITRFPSSAHRYSTPHAFNYTTPYP
PTGSGLSQRQRSTSTPNVHMVSTTLPVDSSIIQDAMRDHDSAGSSPNQSPTGWSQSKAPA
PAQRERVPSFNTQEKNKIRPRDKRDSSYYWEIEASEVYLNSRIGSGSFGTVYKGKWHGDV
AVKILKVTNPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKH
LHVLETNLKMIQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATV
KARWSGSLQVEQPSGSILWMAPEVIRMQDNNPYSFQSDVYSYGIVLFELMTGELPYALIA
NRDQIIFMVGRGYLSPDLSKLYKNCPKAMKRLVADCIKKSKDERPLFPQILSSIELLQHA
LPKINRSASEPSLHRASHTEDINACSLTSTRLPVF
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggagcacctccagggagcgtggaagactctgagcaacggcttcggaatgaaagactct
gcgttcgagggcccgtgcctttcaccaaccatggtgcagggctttccctgccaccgtcgc
tcctcagatgacagcaagatgcccgactccaagactagcagcactatccgagtctacctc
ccaaaccagcaacgcactgtggtaaacgtgcgaccaggtatgactctgcagaattgcctg
attaaagcgttgaaggtgcgaggtctgcagcctcagtgctgtgccgtcttcaggctgcat
ccgggacagaggagtaaaaaactacggatggattggcatactgactccacctctgtgatc
ggggaggagctgctggtggaggttttagatcacgttcctttgacgacgcataattttgtt
cggaaaacatatctgaaacttgctttctgtgatatttgccagaagtttcttttgaatggt
ttccgttgccaaacgtgtggttacaaattccatgagcattgtagcaccaaagtgccaacg
atgtgtgtggactggagcaatatcagacaactcctcctgtgtccaacacccggtgagagc
ggtgccccgtcactgccgccgctgacatcccggcgaatgagagagtccataacaaggttt
ccaagctcagcccaccgatattccacccctcatgccttcaactacaccacgccctaccca
cccacaggcagcggtctctcccagaggcagcgctccacttctacgcccaacgtccacatg
gttagcactaccctgcctgtagacagcagcatcattcaggatgcaatgcgcgatcatgac
tcagcggggagttcccccaatcaaagccctacaggctggtcccaatccaaagcccctgca
cctgcccagcgagagagggtcccgtcctttaatacgcaggagaaaaataaaattaggcca
cgggacaagcgtgactctagttactattgggagattgaagctagcgaggtgtatctgaac
tcccgcatcggctcaggctcctttggaactgtgtacaaagggaaatggcatggtgatgta
gcggtcaagattttaaaggtgaccaaccccacaccagagcagttccaggccttcaggaat
gaagtggctgtcctgaggaaaacgcgacatgtcaacatcctgttgttcatgggctacatg
acgaaggacaacctagccattgtgacccagtggtgtgagggcagcagcctctataaacac
cttcatgtcctggagacaaacttgaagatgatccaactcatagacatcgccaggcagaca
gctcagggcatggactacctgcatgcaaagaacatcattcaccgtgacatgaagtccaac
aatatcttcttgcatgaagggctcacagtgaagattggggactttggtcttgcaacagtg
aaggccaggtggagcggctcacttcaggtggagcagccgtctggatccattctctggatg
gctcctgaggttatccggatgcaggacaacaatccctacagcttccagtctgatgtctat
tcctatggaattgttctttttgagctcatgacgggagagctcccatacgccctcatagca
aatagagatcagattatcttcatggtgggaagaggatatctgtcccccgacctgagtaag
ctctacaagaactgccccaaagccatgaaaaggctggtggccgactgcatcaagaagtcc
aaggatgagaggccactcttcccgcagatcttgtcctccatcgagcttctccagcatgcc
ctccctaagataaaccgcagtgcctcagaaccgtccctgcacagagcctctcacaccgaa
gatattaacgcctgttctctgacttccaccagactgcctgtgttctag

DBGET integrated database retrieval system