KEGG   Paralichthys olivaceus (Japanese flounder): 109635623
Entry
109635623         CDS       T06037                                 

Definition
(RefSeq) protein shisa-5-like
  KO
K10135  scotin
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109635623
SSDB
Motif
Pfam: Shisa Comm
Other DBs
NCBI-GeneID: 109635623
NCBI-ProteinID: XP_019952492
LinkDB
Position
Unknown
AA seq 266 aa
MASGLSGVVVLVLCACLAPHVFASRDSDCLSYRDLNNVYHSYKSCYSGFCCGNCLDRYCC
YTNYLKLSEDQQEDCPVEPILNFYSPVHMIVGIVSLIIALLALICCCVCPCCCLYKMCRK
PQPVIATTTHTTLVTSTPQNYPQQQTATPSHPQSYQGPQYQPYQPVPVQPGYGNQPTPHA
YGAQPMPSTTYQGQPFTPGPPPTYQEATCPAYPPNPMPYSQAAFSPSQPAYPLQPPATQG
PAAPPANTDFHMQPAYNPEYIAPRTG
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcgtcaggcctgagcggtgttgtggtgctggtcctctgtgcctgtctggcccctcat
gtgttcgccagcagggattcagactgcttgtcctacagagatttgaacaacgtgtatcac
tcatacaaatcatgctactctggattttgctgtggaaactgcctcgacagatactgttgt
tacactaattacttgaagctttctgaggaccaacaagaagactgtcctgtcgagcctatt
ttgaatttttattcaccggtccacatgatcgttggtattgtcagcctcatcatcgcgttg
ctcgccctcatctgctgctgtgtctgtccctgctgctgcctgtacaaaatgtgccgcaag
ccacaacctgtgatagctactaccacccacacaacactggtcaccagtactcctcagaat
taccctcaacagcagactgcaacacccagccatcctcagtcctaccaggggccccagtac
cagccctaccagcccgtaccagtgcagccaggatatggcaaccagcccacgccccatgcg
tatggagctcaacccatgccctcaacaacctaccagggtcagccattcacaccagggcca
cctccaacatatcaggaagccacctgtcccgcataccctcccaacccgatgccttacagc
caggctgcgttctcccccagccagccagcgtaccctctacagcctcctgccacgcagggg
cccgcggctccacccgccaacacagacttccatatgcagcctgcatacaacccagaatat
atcgcacccaggactggataa

DBGET integrated database retrieval system