KEGG   Paralichthys olivaceus (Japanese flounder): 109635763
Entry
109635763         CDS       T06037                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109635763 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109635763 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pov04052]
    109635763 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:pov00536]
    109635763 (fgf1)
Cytokines and growth factors [BR:pov04052]
 Growth factors
  Growth factors (RTK binding)
   109635763 (fgf1)
Glycosaminoglycan binding proteins [BR:pov00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109635763 (fgf1)
SSDB
Motif
Pfam: FGF Fascin eIF-6
Other DBs
NCBI-GeneID: 109635763
NCBI-ProteinID: XP_019952688
LinkDB
Position
Unknown
AA seq 152 aa
MTEGDFTVLSFRSTSLDLSRQEHRTLTRLYSQNGGYHLRILPDGTVSGGRQENDPYDILR
LKAVSVGVVVIKGEVTGRFLAMNKNGLLYGSQAMNDECYFLEKYEENHYNTYRSQKYNWY
VALKRNGQPKPGPDTHQGQKAIFFLPRPVGNM
NT seq 459 nt   +upstreamnt  +downstreamnt
atgactgagggagacttcactgtgctgtcgttcagatccacgtctctggatctgtccagg
caggagcaccggacactgaccaggctctacagccagaacggaggctatcatctgaggatt
ttacctgatggcactgtgagtggtgggaggcaggaaaatgacccctatgacatcctcaga
ctgaaggctgtgagtgtgggagtggtggtcatcaagggggaggtgacaggaaggttcctg
gcaatgaacaaaaatggactcctctatggatcacaagcgatgaatgacgagtgttacttc
ctggagaagtatgaagaaaaccactacaacacgtatcgctctcagaagtacaactggtat
gtcgcactgaagagaaatgggcaacccaaaccgggaccggacacacaccaaggtcagaag
gccatctttttcctgccaaggcctgtgggcaacatgtaa

DBGET integrated database retrieval system