KEGG   Paralichthys olivaceus (Japanese flounder): 109635852
Entry
109635852         CDS       T06037                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109635852 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pov03000]
    109635852 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pov03310]
    109635852 (nr3c1)
Transcription factors [BR:pov03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    109635852 (nr3c1)
Nuclear receptors [BR:pov03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   109635852 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR DUF5407
Other DBs
NCBI-GeneID: 109635852
NCBI-ProteinID: XP_019952853
UniProt: O73673
LinkDB
Position
Unknown
AA seq 807 aa
MDQGGLKRNCNRDDSLTFGETAVGVGSDTGDTAGSLLQPAAMHLPSPSSLPQLTVAPNGG
AGTKDQGEFGGLFESPRGQCEGSEMKEGKIIRLQKRKHHLDIGMFNMEDNLSLLNQNISD
LNRTSTSVISTSDTSVLGKLPLPNLFPQHIKQEGGFSLEKELGTYGGHTGGGPCDLDGNS
GHLIEDTEIWQDLDLPNSLPEISDFELDSEVAHLDNILHDSSGGCGPDGSLLKETKVLVG
NGGNCTDVNGTDQQHPLQHHQHQQQQHRHLLQHQQHQLHHQHQQPPSLLSSVMIKEEKDH
DNSFIHIRTPGVVKQEKQENGSFCQSQCLQSSMSSLHGGGPMSSTMGAGAVPGYHYKASP
SSTVGLQDQKPFGIFSNLPAVAESWTRGGRFGEPSGIQRGNDGLPSAAMSPFSVSFSSSS
PRTGENSSSAVPGLSKPSGPTHKICLVCSDEASGCHYGVVTCGSCKVFFKRAVEGWRARQ
NTDGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKNKKLIKMKVHRPTGS
AEPISNMPVPVIPRMPQLVPTMLSVLKAIEPEIIYSGYDSTLPDTSTRLMTTLNRLGGQQ
VISAVKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFSLGWRSYEQCNGNMLCFAPDLVIN
KERMKLPFMTDQCEQMLKICNEFVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIR
MTYIKELGKAIVKREENASQNWQRFYQLTKLLDSMQEMVEGLLQICFYTFVNKTLSVEFP
EMLAEIITNQIPKFKDGSVKPLLFHQK
NT seq 2424 nt   +upstreamnt  +downstreamnt
atggatcagggtggactgaagcgcaactgtaatcgagacgacagcctgacatttggggag
acagcagtcggagtaggcagtgacacaggtgacacggctggttcgctgctccaacccgct
gcgatgcacctgcccagccccagttccctgccccagctaacggtggccccaaacggaggg
gctggcaccaaagaccagggggagttcggaggtctctttgagtcccctcgtggccagtgt
gaagggtcagaaatgaaggagggtaaaatcatcagattgcagaaacgaaaacaccacctg
gatattggtatgttcaacatggaggacaatttgtcgttgctgaaccagaatatttctgat
ctcaaccggacgtccacctctgtcatcagtacttcagacacctccgtcctgggcaaactg
cctttgcccaaccttttcccccagcacatcaagcaggagggaggtttttctctggaaaag
gagctgggcacttacggtggacatacaggcggcggcccgtgtgatttggatggcaacagc
ggtcaccttattgaggataccgagatctggcaagacctggacctccctaattcattgcca
gaaatcagtgattttgagttggattcagaggtggcacacttggataacatcctacatgac
agcagcggcggttgcggtcctgacggcagtttgcttaaggaaacaaaggtcctggtgggc
aacggaggaaactgtaccgatgtgaatggcaccgaccagcagcaccccttacagcatcat
cagcaccagcagcagcagcaccgccacctgctacagcaccagcaacatcagttacaccat
caacatcagcagcctccatcgcttctctccagcgtcatgatcaaggaggagaaagatcac
gacaactctttcatccacatccgcacacctggcgttgtcaaacaggagaagcaggagaat
ggcagtttctgccagtcgcagtgtctccagagcagcatgagctctctgcacggaggaggc
ccgatgtcctcgaccatgggagccggcgcagtacctggctaccactacaaagccagcccg
tcctccaccgtgggcctacaagaccagaagccttttggcattttctcgaatctgcctgca
gtcgcggagagctggacgagggggggcaggtttggagagccgtccgggatacagaggggc
aacgatgggctcccctccgcagccatgtcacccttctctgtcagcttctccagctcgtct
cccagaacaggagagaacagcagctccgctgtgccaggcctgtccaagcccagcggtccg
acccataagatctgtttggtgtgttcggatgaagcttcaggatgccactacggtgtcgta
acctgcggcagttgcaaggtgttcttcaagagggcggtcgaaggatggagagcacgacaa
aacacagatggccaacacaactatctctgtgcaggaaggaacgactgcatcatagataag
atccgcaggaagaactgtccagcctgccgcttcaggaaatgtcttcaagccggaatgaac
ttggaagcgaggaaaaacaagaagctgatcaagatgaaagtgcaccggcccactggatcg
gcagagcccatcagcaacatgccagtccccgtcatccccaggatgccccagcttgtgccg
accatgctgtctgtgctcaaggccatcgagccagagatcatctactctggctacgacagc
actctgcccgacacctccacacgactcatgaccactctcaacaggctgggggggcagcag
gtcatctctgcagtcaagtgggctaagtcactgccaggcttccgcaacctgcacctggac
gaccagatgacattgctgcagtgctcctggctctttctgatgtccttcagtctgggctgg
agatcgtatgagcagtgcaacggcaacatgctctgcttcgcccccgatctcgtcatcaac
aaagagcgaatgaagctgcccttcatgaccgaccagtgcgagcaaatgctgaagatctgc
aatgagtttgtcagactgcaggtgtcctacgacgagtacctgtgtatgaaggtcctatta
ctgctcagtacagtaccaaaagacggcctgaagagccaggcggtgtttgacgagatcagg
atgacgtatatcaaggagcttgggaaagccatcgtcaagagggaggagaacgccagtcaa
aactggcagcgcttctaccagttaactaagctactggactccatgcaggagatggtcgag
ggcctcctccagatctgtttctacacctttgtgaataaaaccctcagcgtggaattcccg
gagatgctggcggagatcatcaccaaccagataccaaaattcaaagatgggagcgtcaag
cctctgctgtttcatcagaaatga

DBGET integrated database retrieval system