KEGG   Paralichthys olivaceus (Japanese flounder): 109637130
Entry
109637130         CDS       T06037                                 

Definition
(RefSeq) cyclin-G2-like
  KO
K10146  cyclin G2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109637130
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109637130
SSDB
Motif
Pfam: Cyclin_N FANCI_S1 Cyclin_C DUF902
Other DBs
NCBI-GeneID: 109637130
NCBI-ProteinID: XP_019954868
LinkDB
Position
Unknown
AA seq 334 aa
MRDLQAIDSLLLKELKTCCAKEYNFLPRETGLKLMESASTEKHSGVSAKCRDTRVEELWG
LTNFFGYSTQTFVQAVNLLDRFLTIMKVQPKHLPCIGVCCLHIASKMVEEESNVSPTHEL
IRISQSKFTVSDLCRMEKIISEKLSVEPKAVTALTFLQLYYSAFTTLSAGREEIPSIGRL
EAQLKACLCQLVFSKAKPSVLALSLIAQEFEALQSTALSKIVKQFQRHLKISDSELLRWK
ELVAKCMTEYHSSECNKPDNKKLVWIVSRRTAQNLQANHFSVPGLPTIPEGSWDESESED
SCEDMSCGEDTPFGSPGSDGEGAFFPSPFHKSRK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgagggatcttcaagccattgacagcttgctcttgaaggagctgaagacttgctgtgcg
aaggagtacaactttcttcccagagagactggcctgaagctcatggagtctgcctccaca
gagaaacacagtggagtgtctgctaaatgcagagacaccagagtggaggagctgtggggc
ctgaccaatttctttggctacagcacccaaacttttgttcaagctgtcaatttgcttgac
agattcctcaccatcatgaaggttcagcccaaacacttgccctgtattggagtctgctgt
cttcatattgcatccaaaatggttgaggaagagagcaatgtctcacccacacacgaactc
attcgcatcagccaaagcaagttcaccgtgtcagacctttgtcgtatggagaagataatt
tccgagaagctcagtgtggagcccaaagcagtgacagccttaacctttcttcaactctac
tactcggccttcacaactctgtctgctggaagggaggagatcccaagcattgggagactg
gaagcccagctaaaagcctgcttatgccagcttgttttctctaaagcaaaaccatcagtg
ctggcgctgtcgctcattgctcaggagtttgaagccctccaatccactgccttgtcaaag
attgtcaagcaattccaaagacatctaaagattagtgacagtgagttgctccgctggaag
gaacttgtggccaagtgcatgaccgagtaccactcgagcgaatgtaacaaaccagacaac
aagaagctggtttggattgtgtccaggagaaccgcacaaaatcttcaggccaatcacttc
agtgtccctggtctgccaactatacctgaaggcagctgggatgagagtgagagtgaggac
tcctgtgaagacatgagctgcggagaagacactccattcggctcgccaggaagtgacggc
gaaggagccttcttcccctctccctttcacaaaagcagaaagtga

KEGG   Paralichthys olivaceus (Japanese flounder): 109643935
Entry
109643935         CDS       T06037                                 

Gene name
ccng1
Definition
(RefSeq) cyclin-G1
  KO
K10145  cyclin G1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109643935 (ccng1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109643935
NCBI-ProteinID: XP_019964789
LinkDB
Position
Unknown
AA seq 299 aa
MIDTVTGPGAQPFAVQLKALTDLEGRYQPKLSGLRFIDCAQDNGLRMTTRLRELEVKDLL
SLTRFFGFSSESFSLAVSLLDRFLSVMKIQPKHLSCVGLCCFYIAVKSSEEEKNVPLAND
LIRISQNRFTVSDMMRMEKIIMEKLYWKVKGPTALRFLRLFHSHIQEQLDAESKKILSLE
RLEAQLKACHCSFVFSKMKPSLLAMALLCYEAQEQHDPDHTDKISEALKGLQQQLRIKDG
DLVCVRELVGKCLSDYATTKCSRPNSQRLRWTISGRTARQLKHSYYKIAHLPTIPESAC
NT seq 900 nt   +upstreamnt  +downstreamnt
atgattgatacagtaacaggacctggagcacaaccctttgcagttcagctgaaggctcta
acagatctggagggccgataccaaccaaagctgagcggcttgaggttcatcgactgcgcc
caggacaacggcctcaggatgaccaccagactccgggagctggaggtgaaggacttgctc
tctctgaccaggttctttggtttcagctcagagagcttctcactggctgtcagcttactg
gatcgattcctctcagtaatgaagattcagccaaaacacctttcctgtgtgggcctgtgc
tgcttctatattgctgtgaaatcctctgaagaggaaaagaacgtgcctctggccaacgac
ctgatccgcatcagtcagaatcgcttcacagtgtcrgacatgatgaggatggagaagatc
atcatggagaagctttactggaaggtgaagggccccacagcgctccgctttctccgcctc
tttcacagccacatccaggagcagctcgacgctgagagcaagaagatcctgagtcttgag
agactggaagctcagctgaaagcttgtcactgctcattcgtcttctctaaaatgaagcca
tctctgcttgccatggctctgctgtgttatgaggcccaggaacaacatgaccctgatcac
actgacaaaatatcagaggccctgaaaggtctgcagcagcagctaagaatcaaagatggg
gacctggtttgtgttcgggagttggtcgggaaatgtctgtctgactacgccaccaccaag
tgctccagacccaacagccagagacttcgctggaccatctcgggtagaactgcccgtcag
ctgaagcatagctactacaagatcgctcatcttcccaccatacccgagtcggcttgttaa

KEGG   Paralichthys olivaceus (Japanese flounder): 109646257
Entry
109646257         CDS       T06037                                 

Definition
(RefSeq) cyclin-G2-like
  KO
K10146  cyclin G2
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04068  FoxO signaling pathway
pov04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109646257
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109646257
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109646257
NCBI-ProteinID: XP_019967541
LinkDB
Position
Unknown
AA seq 333 aa
MDAYKLMKELRVNYEQEVFYLPKETGLSLIESSTQDDSRISAKCRDAKVEDLWSLTSFFG
YSTQTFVLAVNLLDRFLAMMRIQPKHLSCVSLSCLHMAAKVTEDCNVTSTDELIRIGQCR
FTVSDLGRMEKIVSEKLNFKSKAITALTFLQLYHQIALSHSTDRKETLSLEKLEAQLKAC
LCRISFSKAKPSVLALSLLRQEIKAVQSEDMLEIASHIQRHLKIADGELRLWSERVAQCL
SDYSSPECSKPNHRKLQWIVSRRTAQNLHSYRSVPELPTIPEGGWDESESEDSCEDVMSS
GEESLSSSPGSDAEGPFFPLHFRQQKQRQHLLA
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggacgcctataagctgatgaaggagctgcgggtgaattatgagcaggaggttttttat
cttcctaaagaaacaggactgagcctcatcgaatcctccacacaggacgacagtcggatc
tcggccaagtgcagagatgccaaagttgaggacctgtggagtctcaccagcttctttggt
tacagcacgcagaccttcgtcctggctgttaacctgctggacagattcctggccatgatg
aggatccagccgaagcacctgtcctgcgtcagcctcagctgcctccacatggcggccaaa
gtgacggaggactgcaacgtgacgtccacagacgagctcatccgcatcggacagtgcaga
ttcacggtttctgacctcggtcgcatggagaagattgtctccgagaagctcaacttcaag
tccaaagccatcactgccttaacgtttctgcagctgtaccatcagatcgcactttcacac
tccacggacaggaaggagactctgagcctggagaagctggaggctcagctcaaagcctgt
ctgtgccgaatctccttctccaaagcaaagccgtccgtcttagccctgtcgctcctgagg
caggagatcaaagccgttcagtcggaggacatgttggagatcgcctctcatatccagaga
cacttgaagattgcggacggcgagctgcgactgtggagcgaacgcgtggcccagtgtctg
tcggactactcctcgcccgagtgcagcaagcccaaccacaggaagctgcagtggatcgtg
tcgcggcggaccgcccagaacctgcacagctaccgcagcgtccccgagctgcccaccatc
cccgagggaggctgggacgagagcgaaagcgaggactcatgtgaggacgtgatgagttca
ggtgaggagtcgctcagcagctccccgggcagcgacgctgaagggcccttcttccctcta
cacttccgccaacaaaaacaacgtcaacacctccttgcctga

DBGET integrated database retrieval system