KEGG   Paralichthys olivaceus (Japanese flounder): 109637498
Entry
109637498         CDS       T06037                                 

Gene name
braf
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04012  ErbB signaling pathway
pov04068  FoxO signaling pathway
pov04150  mTOR signaling pathway
pov04270  Vascular smooth muscle contraction
pov04510  Focal adhesion
pov04810  Regulation of actin cytoskeleton
pov04910  Insulin signaling pathway
pov04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109637498 (braf)
   04012 ErbB signaling pathway
    109637498 (braf)
   04068 FoxO signaling pathway
    109637498 (braf)
   04150 mTOR signaling pathway
    109637498 (braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109637498 (braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109637498 (braf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109637498 (braf)
   04914 Progesterone-mediated oocyte maturation
    109637498 (braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109637498 (braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pov01001]
    109637498 (braf)
Enzymes [BR:pov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109637498 (braf)
Protein kinases [BR:pov01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   109637498 (braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 109637498
NCBI-ProteinID: XP_019955441
LinkDB
Position
Unknown
AA seq 823 aa
MAALSSAESPPPVFNGDTAEREPGREPGLEELGAGLDASCAPGIPGGPQDEEIWNIKQMI
KLTQEHLEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEAMGNGTDFSCSPT
TTPALLEVKMGSCGTGGGAQAFPTAPNTLAVLQTPTDASRANPRSPQKPIVRVFLPNKQR
TVVPARCGMTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEV
LENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQL
DLLLVSKFFEHHPFTQEEVSSEGTTPVSEACPSLPPSDSMGSICHTTVSPSKSIPIPPSF
RPNEEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQSLPRSDGAPPTHPARCLRKH
RTRTSSPLLYSYPNDIVFDFEPEPVFRGSTTGLSATPPASLPGSLTNVKVPQKSPCQQRE
RKSSSSSEDRNKMQKTLGRRDSSDDWEIPEGQITLGQRIGSGSFGTVFKGKWHGDVAVKM
LNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYTTKPQLAIVTQWCEGSSLYHHLHII
ETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRW
SGSHQFEQLSGSILWMAPEVIRLQDKNPYSFQSDVYAFGIVLYELMSGALPYSNINNRDQ
IIFMVGRGYLSPDLSKVRSNCPKAMKRLMADCLKKKREERPLFPQILASIELLARSLPKI
HRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFSAFK
NT seq 2472 nt   +upstreamnt  +downstreamnt
atggcggcgttgagcagcgccgagtccccaccgcccgtctttaacggagacaccgcggag
cgggagccgggcagggagccgggcctggaggagctgggcgccgggctggacgcctcctgc
gcgccggggatccccggaggtccgcaggatgaggagatctggaacattaaacagatgatt
aagttgacacaagaacacttagaggctcttctggacaagtttggaggagaacacaacccc
ccctccatatatctagaggcctatgaggagtacaccagtaagctagacgccctgcagcag
agggagcagcagctgttggaggccatggggaacggcacagacttctcctgctctcccaca
accacgccagcccttctggaggtcaagatgggtagctgtgggaccggagggggggctcag
gcctttcctactgcccccaacacgttggctgtcctgcagacccccaccgacgccagccga
gccaaccctcgctccccgcagaaacccatcgtgagggtcttcctgcccaacaaacagaga
acagtggtcccagcccgctgtgggatgactgtgagagactcgttgaagaaagctctgatg
atgcgaggcctcatccccgagtgctgtgccgtgtacaggatacaggatggagagaagaag
cccattggctgggacacagacatatcctggctgacaggagaggagttacatgtagaagtg
ttggagaatgtgccacttaccacacacaactttgtgaggaagaccttcttcacactggcc
ttctgtgacttctgcagaaagctgctcttccagggtttccgctgtcagacctgcggttac
aagttccaccagcgctgcagcactgaggttccgctcatgtgcgtcaactacgaccagcta
gacttattgttagtgtccaagttctttgaacatcacccgttcacccaggaggaggtgtcc
tcagagggaaccacccccgtgtctgaggcctgtccgtcacttcccccgtctgactccatg
gggtctatatgccacaccactgtatcaccgtccaagtccatacccatcccgcccagtttc
cggcccaacgaggaggaccaccgcaaccagtttggccagcgggaccgttcgtcctcggcc
cctaacgtccatattaacaccatcgagcctgtcaacatagacgacctgattcgagatcag
agcttaccacggtcagatggagcccccccgacccaccccgcccgctgcttgaggaagcac
cgaacacggacctcaagccccctcctatactcctaccccaatgacatagtgtttgatttt
gagcctgagcctgttttccgaggctccaccacagggctgtcggccacgccacccgcctct
ctacccggctccctgaccaacgtcaaggttccgcagaagtcgccgtgtcaacagagggag
cgcaagtcgtcgtcctcatctgaggaccgcaataagatgcagaaaaccctgggcagaagg
gactccagcgatgactgggaaatcccagagggtcagatcactttgggtcagaggataggc
tctggatcctttggaactgtcttcaagggaaagtggcatggtgacgtggcggtgaagatg
ttgaacgtcaccgcgcccacgccacaacagctccaggccttcaagaacgaagtgggagtc
ctcaggaaaacgcgtcacgtgaacatcctgctgttcatgggctacaccaccaagcctcag
ctggccatcgtaacccagtggtgtgaaggctccagtctgtaccaccacctacacatcatc
gagaccaagtttgagatgatcaagctgatcgacatcgcccggcagactgctcagggcatg
gactacctgcatgcgaaatcaatcatccacagagatttgaagagcaacaatattttcctc
catgaggatctgacggttaagatcggtgactttggcctggctacagtgaagtcccgctgg
agtggctcccaccagtttgagcagctgtctggatctattctgtggatggccccagaggtg
atccggctgcaggacaagaatccctacagcttccagtcagacgtctacgccttcggcatc
gtgctgtacgagctcatgtcaggagcgctgccctactccaacatcaacaaccgagaccag
atcatattcatggtgggtcgaggttacttgtctcctgacctcagcaaagtgcgcagcaac
tgtccaaaggccatgaagaggctgatggccgactgtctgaagaagaagagggaggagcgc
cctctcttccctcagatcctagcgtccatcgaactgctggctcgctcgttacccaaaatc
caccgcagcgcctcggagccttcgttaaaccgagccgggtttcagacagaggacttcagc
ttgtacgcctgcgcctcacccaaaacccccatccaggccggtggctatggggagttttca
gcatttaagtaa

DBGET integrated database retrieval system