KEGG   Paralichthys olivaceus (Japanese flounder): 109637625
Entry
109637625         CDS       T06037                                 

Gene name
serpine1
Definition
(RefSeq) plasminogen activator inhibitor 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04115  p53 signaling pathway
pov04218  Cellular senescence
pov04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109637625 (serpine1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109637625 (serpine1)
   04218 Cellular senescence
    109637625 (serpine1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pov01002]
    109637625 (serpine1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pov04147]
    109637625 (serpine1)
   00536 Glycosaminoglycan binding proteins [BR:pov00536]
    109637625 (serpine1)
Peptidases and inhibitors [BR:pov01002]
 Peptidase inhibitors
  Family I4: serpin family
   109637625 (serpine1)
Exosome [BR:pov04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109637625 (serpine1)
Glycosaminoglycan binding proteins [BR:pov00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   109637625 (serpine1)
SSDB
Motif
Pfam: Serpin FlgI
Other DBs
NCBI-GeneID: 109637625
NCBI-ProteinID: XP_019955647
LinkDB
Position
Unknown
AA seq 389 aa
MFCAYIFLLLTLSRVGLGSLQDKQTDFGLKVFFQLSQGFADKNLAFSPYGAASVLSMAQL
GAAGNTRKALTTAMGFSLQERGMSRQQRLLHRDLSSEEGVEIASGVMVERKMSLEKGYRR
GLTKAFQTHPHQVDFTKPDQAVNIINSWVSDHTAGAISKFLESGSLSEETRLVLLNALHF
QGLWKVPFDPKLTQERMFHCANGSTVPVHMMRLTNYYNYGEFVTPDGVDYDVIEVPYEGD
SLSMLLVSPFEPEVQLNMLSADLSSQRIQQWRGEMRKVRRQLAMPRFTLNTDVNLKTTLL
NMGLGDMFNLASADFTRITTEERLCVSKVLQRVKIEVNERGTKGSAATAAVMFSRMAVEE
ITLDRPFLFLIQHKHTGAVLFMGQFNQPQ
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgttttgtgcttacatattcctgttgctgaccctgagcagagtagggctgggctctctg
caggataaacagactgactttggcctgaaggtcttcttccagcttagccagggctttgcg
gacaagaatctggccttttccccttacggtgcagcctccgtcctgtccatggcacagctt
ggtgctgccggtaacacccgcaaggccctgacgactgctatgggtttttctttgcaagag
cgagggatgtcccggcagcagcgtctcttgcatcgggatctttctagtgaggaaggggtg
gagatagccagcggtgtgatggtggagaggaagatgagtctggagaagggatacagacgg
ggcctgaccaaggccttccagacccaccctcatcaggtggactttactaagccggaccag
gcggtcaacatcatcaactcatgggtgtcagaccacacagcaggtgccatctctaagttc
ttggaatctggatctctgagtgaagagacccgccttgtcctcctgaatgctctccacttc
cagggcctctggaaagttccctttgaccccaaactgacacaggagaggatgttccactgc
gcaaatggcagtactgtccccgtgcacatgatgaggctcacaaactactacaattacggc
gaattcgtaactcctgatggggtggactatgatgtcattgaagtgccatatgagggtgac
tctctgagcatgctgctggtgtcaccctttgaacctgaagttcaactgaacatgctcagc
gcagatctgagcagccagaggattcagcagtggaggggagaaatgaggaaagtcaggagg
cagctggccatgcccaggtttactctgaacacagatgtgaatttgaagactactctgctt
aacatgggtctgggagacatgttcaacctggctagtgctgacttcacacgcatcactaca
gaggaaaggctgtgtgtgtcgaaggtcctccagagagtaaagatcgaggtgaatgagcga
ggaaccaagggatctgcagcaacagctgctgtcatgttttctcgtatggcggtggaggag
atcactctggaccgacccttcctcttcctcatccagcacaaacacacaggtgctgttctg
ttcatgggtcagttcaaccagcctcagtaa

DBGET integrated database retrieval system