KEGG   Paralichthys olivaceus (Japanese flounder): 109637639
Entry
109637639         CDS       T06037                                 

Definition
(RefSeq) putative transcription factor p65 homolog isoform X1
  KO
K04735  transcription factor p65
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04137  Mitophagy - animal
pov04210  Apoptosis
pov04218  Cellular senescence
pov04620  Toll-like receptor signaling pathway
pov04621  NOD-like receptor signaling pathway
pov04622  RIG-I-like receptor signaling pathway
pov04623  Cytosolic DNA-sensing pathway
pov04625  C-type lectin receptor signaling pathway
pov04920  Adipocytokine signaling pathway
pov05132  Salmonella infection
pov05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109637639
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109637639
  09143 Cell growth and death
   04210 Apoptosis
    109637639
   04218 Cellular senescence
    109637639
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109637639
   04621 NOD-like receptor signaling pathway
    109637639
   04622 RIG-I-like receptor signaling pathway
    109637639
   04623 Cytosolic DNA-sensing pathway
    109637639
   04625 C-type lectin receptor signaling pathway
    109637639
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109637639
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109637639
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109637639
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pov03000]
    109637639
Transcription factors [BR:pov03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    109637639
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 109637639
NCBI-ProteinID: XP_019955666
LinkDB
Position
Unknown
AA seq 626 aa
MEAYGWDMTPLNQAGPFIEIIEQPKPRGMRFRYKCEGRSAGSIPGEKSNDTTKTHPAIKV
HNYSGPLRVRISLVTKNAPHKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQCVKKK
DVTEAITCRLQTNNNPFNIPDAKVWEEEFDLNSVRLCFQASITLSTGELFPLEPMVSQPI
YDNRAPNTAELKICRINRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTFSQAD
VHRQVAIVFRTPPFRDTNLTEPIRVKMQLRRPSDREVSEPMDFQYLPSDPDEYRLSEKRK
RTGDMFQSLKLGPMLSSVSISQDRRHISTARRTVTAKPPSMNAQVAAVVLPGASAGKSQP
SYSFNQPGRLFSVQPKVEASSSISAVTTSQTWKIMESLSLGNQPKATPVANFSMSQPPSS
SSSTSTTTSAANPDYSTVNLSDLHEFFPNISSAMAQEPSASLGSTPSSQASSTFNLQSSH
FRVDAPLDDDIPEFPSFSEAQAQGTLDSLNMDDFVDLLNPRLMSESGNCTSMLAQGSCQQ
AASSSSSTVSQNTSDPASNPGSTWMNYPNSIVTLLQNESSIVASNNIHHQAPVLDEFDEL
MSADEDRLISILNSESHVGFVSGHPS
NT seq 1881 nt   +upstreamnt  +downstreamnt
atggaggcgtatggatgggacatgaccccactcaaccaagcaggccccttcatagagatc
attgagcagccgaagccgagggggatgaggttcaggtataagtgtgaaggacgttcagcc
ggcagtatccccggagagaagagcaacgacaccactaagactcacccggccatcaaggtg
cacaactacagcggccccttgcgtgttcgcatttcattggtgacaaagaatgcaccgcac
aagccccacccccacgaactggtcgggaaggactgcaaacatggctactatgaggctgac
ctgcaggagagacgaatacacagttttcagaacctgggcatacagtgtgtgaagaagaag
gatgtgactgaggccatcacttgcaggctccagaccaataataacccctttaacattcca
gacgcgaaggtgtgggaggaggagtttgacctgaattcagtgcggctttgtttccaggcc
tccatcactctgtctacaggagagctgtttccattggagcctatggtgtcacagcccatt
tatgacaacagagccccaaacacggctgagctgaagatctgcagaatcaaccgcaactct
ggaagctgcaagggaggggacgaaatctttctgctgtgtgacaaagtgcaaaaagaggac
atcgaggtgcgtttcttccaggactcttgggagggaaagggcactttctcccaagccgac
gtccacaggcaggtggccatcgtgttccgcacgcctccctttcgcgacactaatctcacc
gagcccatcagagtgaagatgcagctccgccggccctctgatcgcgaggtcagcgagcca
atggacttccagtacttgccttctgacccagatgaatacagactgagtgagaagaggaag
cgcacaggagacatgttccagagcctgaagctgggacccatgttgtcgagtgtgtccatt
tcacaagatagacggcacataagcacagcacggagaacagtcacagccaagcctccgtct
atgaacgcgcaagttgcagctgtggtgctacctggtgccagtgcagggaaatctcagccc
tcctactcattcaatcagccgggtcggctcttctcagtccagcccaaggtagaggcctca
tcctccatctcagctgtgactacaagccaaacatggaagatcatggagagcctgagcctg
ggcaaccagcccaaagccacaccagtggccaacttctcaatgagccagccaccatcttcc
tcctcctccacctctaccaccacctccgctgccaacccagactactcaaccgtcaacctg
tctgatctgcatgaattctttcccaacatttcctccgccatggcccaggagccttccgct
tctctgggtagcacaccatcctcccaggccagcagcaccttcaacctccagagctctcat
ttccgtgtggacgcaccactggatgatgatatcccagagttccctagcttttctgaagct
caggcccaaggcaccctggacagcctaaacatggatgactttgtggaccttctgaacccc
cgcctcatgagcgagagtggaaattgcacctcgatgttggctcagggttcatgccaacag
gctgcctcttccagctcctccactgtttcccagaacacttccgaccccgccagcaaccca
ggaagcacttggatgaattaccccaacagcatcgtcaccttgctccagaacgagagctct
attgttgcatccaacaacatccaccaccaagctcctgtactggatgagtttgatgagttg
atgtccgctgacgaggatcgtcttatttccattctcaacagcgaaagccatgttgggttt
gtctcaggacaccccagttaa

DBGET integrated database retrieval system