KEGG   Paralichthys olivaceus (Japanese flounder): 109638459
Entry
109638459         CDS       T06037                                 

Definition
(RefSeq) epigen-like isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
pov04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109638459
   04012 ErbB signaling pathway
    109638459
SSDB
Motif
Pfam: EGF V_ATPase_I
Other DBs
NCBI-GeneID: 109638459
NCBI-ProteinID: XP_019957009
LinkDB
Position
Unknown
AA seq 261 aa
MTRIFWDTILLISGTFSMSVVLDGSLFTFGAGPSNTTIEARVAIDTYSITAPNTSTSSSA
ATSSISTTTIATTADIQTVNDSLLMFGAGQNNQSAETFIDAGIPIETNFSLAPNTSTTSS
TSTSTTTAATTTTTSVPPVKKFVAAAVWSHFDDCPDSHRHFCFHGTCRFLIVEEMPACVC
HQGFVGMRCEHADLLAVVATNHRQQTVATVLVLCVIGCVLIMVLCTLLHCWWRQDCRRRS
HAHHYVSEKHGASCYPSESVV
NT seq 786 nt   +upstreamnt  +downstreamnt
atgacgaggattttctgggatacaattttactcataagcggtacttttagtatgtctgtg
gttctcgatggttctctctttacatttggagccggaccgagcaacacaacaatcgaagct
cgcgttgccatcgacacatactccatcactgctccaaacacctctacaagcagctctgca
gcgaccagcagcatcagcaccacgacaatcgcaaccacagctgacatccaaacagttaat
gattccctccttatgtttggagcagggcagaacaatcagtcagcagaaacattcatcgat
gccggaattcccattgaaacaaacttttctttggctccgaacacatcaacaaccagcagc
acgagtacctccaccacaactgctgcaacgactacgacgactagcgtccctccagttaaa
aagtttgtggcggccgctgtttggtctcatttcgacgactgtccagactcccatcgccat
ttctgcttccatggtacatgtcgcttcctgatagtggaggagatgccagcatgtgtgtgc
catcagggttttgtcgggatgaggtgtgaacacgccgacctgctcgctgtcgtggcaaca
aaccacagacagcagaccgttgccacagtgctggtgttgtgtgttatcggatgtgttctg
atcatggtgttgtgtacacttttacattgctggtggagacaggactgtcggaggcggagc
cacgcacatcactacgtctcagagaagcatggagcatcctgctatccatcggagagtgtg
gtttga

DBGET integrated database retrieval system