KEGG   Paralichthys olivaceus (Japanese flounder): 109638487
Entry
109638487         CDS       T06037                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
pov  Paralichthys olivaceus (Japanese flounder)
SSDB
Motif
Pfam: C1_1 C1_2
Other DBs
NCBI-GeneID: 109638487
NCBI-ProteinID: XP_019957038
LinkDB
Position
Unknown
AA seq 187 aa
MSKCELIELQDLSLNDPIELAAPAARGAPPSAQPCSFSVVRLVGDSVSIEAPGCQTGETG
VGHDFQVYSHAHPTWCDLCGEFIWGLYKQGLRCTNCSYTCHYRCRPFIRLDCSTDGGLFT
HQGDFSVDAIETDTNVDEQIDLGKQGLSVGEIQQKVKEYNAQINSNLSMMVVSDTXTIFL
NLQSTPI
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtctaaatgtgagctgatcgagctgcaggacctcagtctgaatgatcccatcgagctg
gctgcccctgcggcccgtggcgccccaccatcggctcagccctgctccttcagcgtcgtc
cgtctggttggagacagcgtcagcatcgaggcacccgggtgtcagacaggagagactgga
gtgggtcatgacttccaggtctacagtcacgctcaccccacctggtgtgacctgtgtgga
gaattcatctggggtctctacaagcagggtttacgctgcaccaactgcagttacacctgt
cactaccgctgtcgaccatttatccgactggactgcagcacagatggaggtttgttcaca
caccagggagacttctctgttgacgccatcgagacagacactaatgtggatgaacagatc
gatttgggtaaacagggtttaagtgtcggggagattcagcagaaggttaaagagtataac
gctcagatcaacagtaatctctccatgatggtggtgagtgacacataaactatatttctg
aacttacagtcaactcccatctga

DBGET integrated database retrieval system